Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54633..54897 | Replicon | plasmid p2 |
| Accession | NZ_CP028485 | ||
| Organism | Escherichia coli strain E41-1 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | C2U19_RS27395 | Protein ID | WP_001387489.1 |
| Coordinates | 54745..54897 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 54633..54693 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C2U19_RS27380 | 50735..51805 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| C2U19_RS27385 | 51824..53032 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| C2U19_RS27390 | 53339..54430 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
| - | 54633..54693 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 54633..54693 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 54633..54693 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 54633..54693 | - | 61 | NuclAT_0 | - | Antitoxin |
| C2U19_RS27395 | 54745..54897 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| C2U19_RS27400 | 54969..55220 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| C2U19_RS27405 | 55520..55816 | + | 297 | WP_011264046.1 | hypothetical protein | - |
| C2U19_RS28345 | 55881..56057 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| C2U19_RS27410 | 56449..56658 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| C2U19_RS27415 | 56730..57392 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| C2U19_RS27420 | 57463..59631 | - | 2169 | WP_058649949.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..86657 | 86657 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T101320 WP_001387489.1 NZ_CP028485:54745-54897 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T101320 NZ_CP028485:54745-54897 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT101320 NZ_CP028485:c54693-54633 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|