Detailed information of TA system TA101316

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 108663..108905
• Replicon: plasmid p1
• Accession: NZ_CP028484
• Organism: Escherichia coli strain E41-1

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: C2U19_RS26865
• Protein ID: WP_001312861.1
• Coordinates: 108747..108905 (+)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	108663..108703 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C2U19_RS26845	103858..105816	+	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-
C2U19_RS26850	105871..106305	+	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
C2U19_RS26855	106302..107021	+	720	WP_001276232.1	plasmid SOS inhibition protein A	-
-	107033..107219	+	187	NuclAT_0	-	-
-	107033..107219	+	187	NuclAT_0	-	-
-	107033..107219	+	187	NuclAT_0	-	-
-	107033..107219	+	187	NuclAT_0	-	-
C2U19_RS26860	107267..108636	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
-	108663..108703	+	41	NuclAT_1	-	Antitoxin
-	108663..108703	+	41	NuclAT_1	-	Antitoxin
-	108663..108703	+	41	NuclAT_1	-	Antitoxin
-	108663..108703	+	41	NuclAT_1	-	Antitoxin
C2U19_RS26865	108747..108905	+	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
C2U19_RS26885	109826..110134	+	309	WP_110204518.1	hypothetical protein	-
C2U19_RS26890	110163..110860	+	698	Protein_130	IS1 family transposase	-
C2U19_RS26895	110908..111228	+	321	WP_001348757.1	conjugal transfer protein TrbA	-
C2U19_RS26900	111355..111639	+	285	WP_001617873.1	type-F conjugative transfer system pilin chaperone TraQ	-
C2U19_RS26905	111626..112171	+	546	WP_000059829.1	type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	-
C2U19_RS26910	112101..112448	+	348	WP_071571857.1	P-type conjugative transfer protein TrbJ	-
C2U19_RS26915	112396..112821	+	426	WP_001348758.1	F-type conjugal transfer protein TrbF	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	blaTEM-1B / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17	senB	1..128911	128911
	-	inside	IScluster/Tn	-	-	107267..110860	3593

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T101316 WP_001312861.1 NZ_CP028484:108747-108905 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

>T101316 NZ_CP028484:108747-108905 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG

Antitoxin

Nucleotide

• Length: 41 bp

>AT101316 NZ_CP028484:108663-108703 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin