Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2453601..2453785 | Replicon | chromosome |
Accession | NZ_CP028470 | ||
Organism | Staphylococcus aureus strain IT4-R |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | C5Y81_RS12665 | Protein ID | WP_000482647.1 |
Coordinates | 2453678..2453785 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2453601..2453661 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5Y81_RS12655 | 2449453..2451186 | - | 1734 | WP_000486501.1 | ABC transporter ATP-binding protein/permease | - |
C5Y81_RS12660 | 2451211..2452974 | - | 1764 | Protein_2348 | ABC transporter ATP-binding protein | - |
- | 2453601..2453661 | + | 61 | - | - | Antitoxin |
C5Y81_RS12665 | 2453678..2453785 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
C5Y81_RS12670 | 2453919..2454305 | - | 387 | WP_000779356.1 | flippase GtxA | - |
C5Y81_RS12675 | 2454573..2455715 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
C5Y81_RS12680 | 2455775..2456434 | + | 660 | WP_000831298.1 | membrane protein | - |
C5Y81_RS12685 | 2456613..2457824 | + | 1212 | WP_001191976.1 | multidrug effflux MFS transporter | - |
C5Y81_RS12690 | 2457947..2458420 | - | 474 | WP_000456498.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sbi / hlgA / hlgA / hlgC / hlgB | 2437079..2454305 | 17226 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T101255 WP_000482647.1 NZ_CP028470:c2453785-2453678 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T101255 NZ_CP028470:c2453785-2453678 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT101255 NZ_CP028470:2453601-2453661 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|