Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1813700..1813880 | Replicon | chromosome |
| Accession | NZ_CP028470 | ||
| Organism | Staphylococcus aureus strain IT4-R | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | C5Y81_RS08910 | Protein ID | WP_001801861.1 |
| Coordinates | 1813700..1813795 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1813823..1813880 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5Y81_RS08865 | 1809481..1810107 | + | 627 | WP_000669029.1 | hypothetical protein | - |
| C5Y81_RS08870 | 1810148..1810489 | + | 342 | WP_000627536.1 | DUF3969 family protein | - |
| C5Y81_RS08875 | 1810590..1811162 | + | 573 | WP_000414208.1 | hypothetical protein | - |
| C5Y81_RS08880 | 1811359..1811928 | - | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C5Y81_RS08890 | 1812301..1812477 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| C5Y81_RS08895 | 1812488..1812871 | - | 384 | WP_000070809.1 | hypothetical protein | - |
| C5Y81_RS08900 | 1813053..1813277 | - | 225 | WP_001805677.1 | IS3 family transposase | - |
| C5Y81_RS08905 | 1813451..1813555 | - | 105 | WP_001670380.1 | transposase | - |
| C5Y81_RS08910 | 1813700..1813795 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1813823..1813880 | - | 58 | - | - | Antitoxin |
| C5Y81_RS08915 | 1813918..1814019 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| C5Y81_RS08920 | 1813997..1814169 | - | 173 | Protein_1683 | transposase | - |
| C5Y81_RS08925 | 1814363..1814740 | - | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
| C5Y81_RS08930 | 1814946..1815386 | - | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
| C5Y81_RS08935 | 1815431..1817044 | + | 1614 | WP_000926708.1 | lipase | - |
| C5Y81_RS08940 | 1817059..1817358 | + | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| C5Y81_RS08945 | 1817673..1818854 | - | 1182 | WP_000162901.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 1786551..1830108 | 43557 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T101243 WP_001801861.1 NZ_CP028470:1813700-1813795 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T101243 NZ_CP028470:1813700-1813795 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT101243 NZ_CP028470:c1813880-1813823 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|