Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2152666..2152864 | Replicon | chromosome |
Accession | NZ_CP028468 | ||
Organism | Staphylococcus aureus strain IT1-S |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | C5Y45_RS11030 | Protein ID | WP_075583739.1 |
Coordinates | 2152760..2152864 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2152666..2152704 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C5Y45_RS11010 | 2148769..2149434 | - | 666 | WP_001024097.1 | SDR family oxidoreductase | - |
C5Y45_RS11015 | 2149586..2149906 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
C5Y45_RS11020 | 2149908..2150888 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
C5Y45_RS11025 | 2151154..2152245 | + | 1092 | WP_000495680.1 | hypothetical protein | - |
- | 2152666..2152704 | + | 39 | - | - | Antitoxin |
C5Y45_RS11030 | 2152760..2152864 | - | 105 | WP_075583739.1 | hypothetical protein | Toxin |
C5Y45_RS11035 | 2152962..2153123 | - | 162 | Protein_2044 | helix-turn-helix domain-containing protein | - |
C5Y45_RS11045 | 2153541..2153699 | + | 159 | WP_024928151.1 | hypothetical protein | - |
C5Y45_RS11055 | 2154358..2155215 | - | 858 | WP_000370944.1 | Cof-type HAD-IIB family hydrolase | - |
C5Y45_RS11060 | 2155283..2156065 | - | 783 | WP_000908181.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3861.73 Da Isoelectric Point: 7.0039
>T101237 WP_075583739.1 NZ_CP028468:c2152864-2152760 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISNQGHKK
Download Length: 105 bp
>T101237 NZ_CP028468:c2152864-2152760 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTAATCAAGGCCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT101237 NZ_CP028468:2152666-2152704 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|