Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25536..25806 | Replicon | plasmid pRM9131-2 |
| Accession | NZ_CP028431 | ||
| Organism | Escherichia coli strain RM9131 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | ECRM9131_RS28670 | Protein ID | WP_001312861.1 |
| Coordinates | 25648..25806 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 25536..25599 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECRM9131_RS28625 | 20597..20857 | + | 261 | WP_071600428.1 | hypothetical protein | - |
| ECRM9131_RS28645 | 21330..21857 | + | 528 | WP_000290792.1 | single-stranded DNA-binding protein | - |
| ECRM9131_RS28650 | 21913..22146 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| ECRM9131_RS28655 | 22205..24163 | + | 1959 | WP_001145472.1 | ParB/RepB/Spo0J family partition protein | - |
| ECRM9131_RS28660 | 24218..24652 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| ECRM9131_RS28665 | 24649..25368 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| ECRM9131_RS29350 | 25380..25568 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 25380..25604 | + | 225 | NuclAT_0 | - | - |
| - | 25380..25604 | + | 225 | NuclAT_0 | - | - |
| - | 25380..25604 | + | 225 | NuclAT_0 | - | - |
| - | 25380..25604 | + | 225 | NuclAT_0 | - | - |
| - | 25536..25599 | - | 64 | - | - | Antitoxin |
| ECRM9131_RS28670 | 25648..25806 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| ECRM9131_RS28690 | 26728..27015 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| ECRM9131_RS28695 | 27136..27957 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| ECRM9131_RS28700 | 28254..28763 | - | 510 | Protein_33 | transglycosylase SLT domain-containing protein | - |
| ECRM9131_RS28705 | 29177..29560 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| ECRM9131_RS28710 | 29747..30436 | + | 690 | WP_000283394.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espP / hlyC / hlyA / hlyB / hlyD | 1..76698 | 76698 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T101180 WP_001312861.1 NZ_CP028431:25648-25806 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T101180 NZ_CP028431:25648-25806 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT101180 NZ_CP028431:c25599-25536 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|