Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 72784..72999 | Replicon | plasmid unnamed1 |
Accession | NZ_CP028286 | ||
Organism | Enterococcus faecalis strain FDAARGOS_324 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | CEQ02_RS16020 | Protein ID | WP_107164701.1 |
Coordinates | 72889..72999 (-) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 72784..72848 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CEQ02_RS15995 | 67863..67946 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
CEQ02_RS16000 | 68071..68808 | + | 738 | WP_001038790.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
CEQ02_RS16010 | 69163..69717 | + | 555 | WP_000576156.1 | recombinase family protein | - |
CEQ02_RS16015 | 69721..72639 | + | 2919 | WP_001240982.1 | Tn3 family transposase | - |
- | 72784..72848 | + | 65 | - | - | Antitoxin |
CEQ02_RS16020 | 72889..72999 | - | 111 | WP_107164701.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CEQ02_RS16030 | 73250..73600 | - | 351 | WP_033785382.1 | hypothetical protein | - |
CEQ02_RS16035 | 73597..74925 | - | 1329 | WP_021164484.1 | Y-family DNA polymerase | - |
CEQ02_RS16040 | 75352..75654 | - | 303 | WP_033785383.1 | hypothetical protein | - |
CEQ02_RS16045 | 75666..75875 | - | 210 | WP_002382045.1 | hypothetical protein | - |
CEQ02_RS16050 | 75936..76160 | - | 225 | WP_010708492.1 | hypothetical protein | - |
CEQ02_RS16055 | 76154..76441 | - | 288 | WP_010708491.1 | hypothetical protein | - |
CEQ02_RS16060 | 76458..77078 | - | 621 | WP_021732893.1 | recombinase family protein | - |
CEQ02_RS16065 | 77178..77981 | - | 804 | WP_002367820.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) | cylA / cylA / cylA / cylB / cylB / cylM / cylM / cylM / cylM / cylS / cylL / asa1 / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 | 1..103690 | 103690 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4090.89 Da Isoelectric Point: 4.1672
>T100945 WP_107164701.1 NZ_CP028286:c72999-72889 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 111 bp
>T100945 NZ_CP028286:c72999-72889 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT100945 NZ_CP028286:72784-72848 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|