Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 7525..7766 | Replicon | plasmid unnamed2 |
Accession | NZ_CP028284 | ||
Organism | Enterococcus faecalis strain FDAARGOS_324 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | CEQ02_RS00345 | Protein ID | WP_002360667.1 |
Coordinates | 7656..7766 (-) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 7525..7616 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CEQ02_RS00320 | 2672..4309 | - | 1638 | WP_107164630.1 | peptide pheromone-binding protein TraC | - |
CEQ02_RS00325 | 4468..5475 | - | 1008 | WP_010715977.1 | replication initiator protein A | - |
CEQ02_RS00330 | 5735..6091 | - | 357 | WP_002360663.1 | hypothetical protein | - |
CEQ02_RS00335 | 6084..6866 | - | 783 | WP_002360664.1 | ParA family protein | - |
CEQ02_RS00340 | 7120..7416 | - | 297 | WP_002360665.1 | replication control protein PrgN | - |
- | 7525..7616 | + | 92 | NuclAT_0 | - | Antitoxin |
- | 7525..7616 | + | 92 | NuclAT_0 | - | Antitoxin |
- | 7525..7616 | + | 92 | NuclAT_0 | - | Antitoxin |
- | 7525..7616 | + | 92 | NuclAT_0 | - | Antitoxin |
CEQ02_RS00345 | 7656..7766 | - | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CEQ02_RS00355 | 8017..8367 | - | 351 | WP_002399364.1 | hypothetical protein | - |
CEQ02_RS00360 | 8364..9692 | - | 1329 | WP_002370254.1 | Y-family DNA polymerase | - |
CEQ02_RS00365 | 10119..10421 | - | 303 | WP_002365939.1 | hypothetical protein | - |
CEQ02_RS00370 | 10433..10642 | - | 210 | WP_002383636.1 | hypothetical protein | - |
CEQ02_RS00375 | 10890..11495 | - | 606 | WP_000238804.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | prgB/asc10 | 1..78592 | 78592 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T100932 WP_002360667.1 NZ_CP028284:c7766-7656 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T100932 NZ_CP028284:c7766-7656 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 92 bp
>AT100932 NZ_CP028284:7525-7616 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|