Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-SR6/- |
Location | 1445203..1445420 | Replicon | chromosome |
Accession | NZ_CP028213 | ||
Organism | Bacillus subtilis strain SRCM102749 |
Toxin (Protein)
Gene name | yonT | Uniprot ID | A0A6H0WKE8 |
Locus tag | C7M27_RS07605 | Protein ID | WP_032721653.1 |
Coordinates | 1445244..1445420 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SR6 | ||
Locus tag | - | ||
Coordinates | 1445203..1445303 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7M27_RS07585 | 1440518..1442392 | - | 1875 | Protein_1483 | hypothetical protein | - |
C7M27_RS07590 | 1442432..1442626 | - | 195 | WP_072692657.1 | hypothetical protein | - |
C7M27_RS07595 | 1443578..1443904 | + | 327 | WP_128740476.1 | helix-turn-helix domain-containing protein | - |
C7M27_RS07600 | 1444099..1444710 | + | 612 | WP_128740475.1 | hypothetical protein | - |
- | 1445203..1445303 | - | 101 | NuclAT_0 | - | Antitoxin |
- | 1445203..1445303 | - | 101 | NuclAT_0 | - | Antitoxin |
- | 1445203..1445303 | - | 101 | NuclAT_0 | - | Antitoxin |
- | 1445203..1445303 | - | 101 | NuclAT_0 | - | Antitoxin |
C7M27_RS07605 | 1445244..1445420 | + | 177 | WP_032721653.1 | hypothetical protein | Toxin |
C7M27_RS07610 | 1445439..1445690 | + | 252 | WP_080010576.1 | hypothetical protein | - |
C7M27_RS07615 | 1445735..1445923 | + | 189 | WP_003230987.1 | hypothetical protein | - |
C7M27_RS07620 | 1446005..1447222 | + | 1218 | WP_128740474.1 | hypothetical protein | - |
C7M27_RS07625 | 1447564..1447767 | + | 204 | WP_128740473.1 | hypothetical protein | - |
C7M27_RS07630 | 1447831..1448034 | + | 204 | WP_124048602.1 | hypothetical protein | - |
C7M27_RS07635 | 1448190..1448411 | + | 222 | WP_128740472.1 | hypothetical protein | - |
C7M27_RS07640 | 1448436..1448747 | + | 312 | WP_128740471.1 | hypothetical protein | - |
C7M27_RS07645 | 1448783..1448977 | + | 195 | WP_128740470.1 | hypothetical protein | - |
C7M27_RS07650 | 1448977..1449213 | + | 237 | WP_128740469.1 | hypothetical protein | - |
C7M27_RS07655 | 1449228..1449491 | + | 264 | WP_128740468.1 | hypothetical protein | - |
C7M27_RS07660 | 1449478..1449699 | + | 222 | WP_128740467.1 | hypothetical protein | - |
C7M27_RS07665 | 1449728..1449934 | + | 207 | WP_128740466.1 | hypothetical protein | - |
C7M27_RS21850 | 1449969..1450127 | + | 159 | WP_164914267.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1378847..1514792 | 135945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6850.39 Da Isoelectric Point: 12.8833
>T100897 WP_032721653.1 NZ_CP028213:1445244-1445420 [Bacillus subtilis]
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
>T100897 NZ_CP028213:1445244-1445420 [Bacillus subtilis]
GTGCTTGAGAAAGTGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCAGATGA
GTGCTTGAGAAAGTGGGTATCGTAGTTGCTTTCCTCATATCTTTAACGGTTCTTACAATCAACAGTCTAACAATAGTTGA
GAAGGTAAGAAACCTAAAGAATGGGACAAGCAAAAAGAAAAAGCGTATACGCAAGCGGCTCCGACCAAAGAGACAACGCC
AACGTATACGCAGATGA
Antitoxin
Download Length: 101 bp
>AT100897 NZ_CP028213:c1445303-1445203 [Bacillus subtilis]
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
GATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTACGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTA
TGACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|