Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2788072..2788252 | Replicon | chromosome |
| Accession | NZ_CP028190 | ||
| Organism | Staphylococcus aureus strain CFSAN018749 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | C9J86_RS14140 | Protein ID | WP_001801861.1 |
| Coordinates | 2788072..2788167 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2788195..2788252 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9J86_RS14105 | 2783216..2783842 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| C9J86_RS14110 | 2783883..2784227 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| C9J86_RS14115 | 2784325..2784897 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| C9J86_RS14120 | 2785046..2786413 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| C9J86_RS14125 | 2786413..2786982 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C9J86_RS14130 | 2787175..2787621 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| C9J86_RS14140 | 2788072..2788167 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2788195..2788252 | - | 58 | - | - | Antitoxin |
| C9J86_RS14145 | 2788290..2788391 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| C9J86_RS14150 | 2788566..2788913 | - | 348 | Protein_2669 | DUF1433 domain-containing protein | - |
| C9J86_RS14160 | 2790672..2791115 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| C9J86_RS14165 | 2791115..2791557 | - | 443 | Protein_2672 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T100810 WP_001801861.1 NZ_CP028190:2788072-2788167 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T100810 NZ_CP028190:2788072-2788167 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT100810 NZ_CP028190:c2788252-2788195 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|