Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 38068..38332 | Replicon | plasmid pGMI17-004_1 |
Accession | NZ_CP028168 | ||
Organism | Escherichia coli strain CFSAN064036 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | C6668_RS25485 | Protein ID | WP_001331364.1 |
Coordinates | 38068..38220 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 38275..38332 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6668_RS25465 | 33346..35508 | + | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
C6668_RS25470 | 35573..36235 | + | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
C6668_RS25475 | 36307..36516 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
C6668_RS26450 | 36908..37084 | + | 177 | WP_001054904.1 | hypothetical protein | - |
C6668_RS25480 | 37149..37445 | - | 297 | WP_001275298.1 | hypothetical protein | - |
C6668_RS25485 | 38068..38220 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- | 38275..38332 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 38275..38332 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 38275..38332 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 38275..38332 | + | 58 | NuclAT_0 | - | Antitoxin |
C6668_RS25490 | 38512..39720 | + | 1209 | WP_000121274.1 | IncI1-type conjugal transfer protein TrbA | - |
C6668_RS25495 | 39739..40809 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
C6668_RS25500 | 40802..43093 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / sul1 / qacE / ant(3'')-Ia / dfrA1 / aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) | - | 1..119076 | 119076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T100755 WP_001331364.1 NZ_CP028168:c38220-38068 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T100755 NZ_CP028168:c38220-38068 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT100755 NZ_CP028168:38275-38332 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|