Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1218547..1218731 | Replicon | chromosome |
Accession | NZ_CP028165 | ||
Organism | Staphylococcus aureus strain CFSAN064037 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | C9J78_RS06395 | Protein ID | WP_000482647.1 |
Coordinates | 1218624..1218731 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1218547..1218607 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C9J78_RS06370 | 1214001..1214168 | - | 168 | WP_031901225.1 | hypothetical protein | - |
C9J78_RS06380 | 1214399..1216132 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
C9J78_RS06385 | 1216157..1217920 | - | 1764 | WP_103145546.1 | ABC transporter ATP-binding protein/permease | - |
- | 1218547..1218607 | + | 61 | - | - | Antitoxin |
C9J78_RS06395 | 1218624..1218731 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
C9J78_RS06400 | 1218865..1219251 | - | 387 | WP_000779350.1 | flippase GtxA | - |
C9J78_RS06405 | 1219519..1220661 | + | 1143 | WP_001176867.1 | glycerate kinase | - |
C9J78_RS06410 | 1220721..1221380 | + | 660 | WP_000831298.1 | membrane protein | - |
C9J78_RS06415 | 1221563..1222774 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
C9J78_RS06420 | 1222897..1223370 | - | 474 | WP_000456488.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T100724 WP_000482647.1 NZ_CP028165:c1218731-1218624 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T100724 NZ_CP028165:c1218731-1218624 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT100724 NZ_CP028165:1218547-1218607 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|