Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 579698..579878 | Replicon | chromosome |
| Accession | NZ_CP028165 | ||
| Organism | Staphylococcus aureus strain CFSAN064037 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | C9J78_RS02775 | Protein ID | WP_001801861.1 |
| Coordinates | 579698..579793 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 579821..579878 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9J78_RS02735 | 574765..575337 | + | 573 | WP_000414229.1 | hypothetical protein | - |
| C9J78_RS02740 | 575713..576549 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
| C9J78_RS02750 | 577356..577541 | - | 186 | WP_000809858.1 | hypothetical protein | - |
| C9J78_RS02755 | 577543..577719 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| C9J78_RS02760 | 577730..578113 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| C9J78_RS02765 | 578800..579246 | - | 447 | WP_000747809.1 | DUF1433 domain-containing protein | - |
| C9J78_RS02775 | 579698..579793 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 579821..579878 | - | 58 | - | - | Antitoxin |
| C9J78_RS02780 | 579916..580017 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| C9J78_RS02785 | 580055..580171 | - | 117 | Protein_533 | transposase | - |
| C9J78_RS02790 | 580680..584792 | - | 4113 | WP_107240618.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 576537..649805 | 73268 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T100717 WP_001801861.1 NZ_CP028165:579698-579793 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T100717 NZ_CP028165:579698-579793 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT100717 NZ_CP028165:c579878-579821 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|