Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1749136..1749356 Replicon chromosome
Accession NZ_CP028126
Organism Escherichia coli O26 str. RM10386

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag I3U_RS10975 Protein ID WP_000170954.1
Coordinates 1749136..1749243 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1749293..1749356 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I3U_RS10950 1744980..1746062 + 1083 WP_000804726.1 peptide chain release factor 1 -
I3U_RS10955 1746062..1746895 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
I3U_RS10960 1746892..1747284 + 393 WP_000200378.1 invasion regulator SirB2 -
I3U_RS10965 1747288..1748097 + 810 WP_001257045.1 invasion regulator SirB1 -
I3U_RS10970 1748133..1748987 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I3U_RS10975 1749136..1749243 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1749293..1749356 + 64 NuclAT_32 - Antitoxin
- 1749293..1749356 + 64 NuclAT_32 - Antitoxin
- 1749293..1749356 + 64 NuclAT_32 - Antitoxin
- 1749293..1749356 + 64 NuclAT_32 - Antitoxin
- 1749293..1749356 + 64 NuclAT_35 - Antitoxin
- 1749293..1749356 + 64 NuclAT_35 - Antitoxin
- 1749293..1749356 + 64 NuclAT_35 - Antitoxin
- 1749293..1749356 + 64 NuclAT_35 - Antitoxin
- 1749293..1749356 + 64 NuclAT_38 - Antitoxin
- 1749293..1749356 + 64 NuclAT_38 - Antitoxin
- 1749293..1749356 + 64 NuclAT_38 - Antitoxin
- 1749293..1749356 + 64 NuclAT_38 - Antitoxin
- 1749293..1749356 + 64 NuclAT_41 - Antitoxin
- 1749293..1749356 + 64 NuclAT_41 - Antitoxin
- 1749293..1749356 + 64 NuclAT_41 - Antitoxin
- 1749293..1749356 + 64 NuclAT_41 - Antitoxin
- 1749293..1749356 + 64 NuclAT_44 - Antitoxin
- 1749293..1749356 + 64 NuclAT_44 - Antitoxin
- 1749293..1749356 + 64 NuclAT_44 - Antitoxin
- 1749293..1749356 + 64 NuclAT_44 - Antitoxin
- 1749293..1749356 + 64 NuclAT_47 - Antitoxin
- 1749293..1749356 + 64 NuclAT_47 - Antitoxin
- 1749293..1749356 + 64 NuclAT_47 - Antitoxin
- 1749293..1749356 + 64 NuclAT_47 - Antitoxin
I3U_RS10980 1749671..1749778 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1749831..1749892 + 62 NuclAT_31 - -
- 1749831..1749892 + 62 NuclAT_31 - -
- 1749831..1749892 + 62 NuclAT_31 - -
- 1749831..1749892 + 62 NuclAT_31 - -
- 1749831..1749892 + 62 NuclAT_34 - -
- 1749831..1749892 + 62 NuclAT_34 - -
- 1749831..1749892 + 62 NuclAT_34 - -
- 1749831..1749892 + 62 NuclAT_34 - -
- 1749831..1749892 + 62 NuclAT_37 - -
- 1749831..1749892 + 62 NuclAT_37 - -
- 1749831..1749892 + 62 NuclAT_37 - -
- 1749831..1749892 + 62 NuclAT_37 - -
- 1749831..1749892 + 62 NuclAT_40 - -
- 1749831..1749892 + 62 NuclAT_40 - -
- 1749831..1749892 + 62 NuclAT_40 - -
- 1749831..1749892 + 62 NuclAT_40 - -
- 1749831..1749892 + 62 NuclAT_43 - -
- 1749831..1749892 + 62 NuclAT_43 - -
- 1749831..1749892 + 62 NuclAT_43 - -
- 1749831..1749892 + 62 NuclAT_43 - -
- 1749831..1749892 + 62 NuclAT_46 - -
- 1749831..1749892 + 62 NuclAT_46 - -
- 1749831..1749892 + 62 NuclAT_46 - -
- 1749831..1749892 + 62 NuclAT_46 - -
- 1749831..1749894 + 64 NuclAT_17 - -
- 1749831..1749894 + 64 NuclAT_17 - -
- 1749831..1749894 + 64 NuclAT_17 - -
- 1749831..1749894 + 64 NuclAT_17 - -
- 1749831..1749894 + 64 NuclAT_19 - -
- 1749831..1749894 + 64 NuclAT_19 - -
- 1749831..1749894 + 64 NuclAT_19 - -
- 1749831..1749894 + 64 NuclAT_19 - -
- 1749831..1749894 + 64 NuclAT_21 - -
- 1749831..1749894 + 64 NuclAT_21 - -
- 1749831..1749894 + 64 NuclAT_21 - -
- 1749831..1749894 + 64 NuclAT_21 - -
- 1749831..1749894 + 64 NuclAT_23 - -
- 1749831..1749894 + 64 NuclAT_23 - -
- 1749831..1749894 + 64 NuclAT_23 - -
- 1749831..1749894 + 64 NuclAT_23 - -
- 1749831..1749894 + 64 NuclAT_25 - -
- 1749831..1749894 + 64 NuclAT_25 - -
- 1749831..1749894 + 64 NuclAT_25 - -
- 1749831..1749894 + 64 NuclAT_25 - -
- 1749831..1749894 + 64 NuclAT_27 - -
- 1749831..1749894 + 64 NuclAT_27 - -
- 1749831..1749894 + 64 NuclAT_27 - -
- 1749831..1749894 + 64 NuclAT_27 - -
I3U_RS10990 1750207..1750314 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1750362..1750427 + 66 NuclAT_30 - -
- 1750362..1750427 + 66 NuclAT_30 - -
- 1750362..1750427 + 66 NuclAT_30 - -
- 1750362..1750427 + 66 NuclAT_30 - -
- 1750362..1750427 + 66 NuclAT_33 - -
- 1750362..1750427 + 66 NuclAT_33 - -
- 1750362..1750427 + 66 NuclAT_33 - -
- 1750362..1750427 + 66 NuclAT_33 - -
- 1750362..1750427 + 66 NuclAT_36 - -
- 1750362..1750427 + 66 NuclAT_36 - -
- 1750362..1750427 + 66 NuclAT_36 - -
- 1750362..1750427 + 66 NuclAT_36 - -
- 1750362..1750427 + 66 NuclAT_39 - -
- 1750362..1750427 + 66 NuclAT_39 - -
- 1750362..1750427 + 66 NuclAT_39 - -
- 1750362..1750427 + 66 NuclAT_39 - -
- 1750362..1750427 + 66 NuclAT_42 - -
- 1750362..1750427 + 66 NuclAT_42 - -
- 1750362..1750427 + 66 NuclAT_42 - -
- 1750362..1750427 + 66 NuclAT_42 - -
- 1750362..1750427 + 66 NuclAT_45 - -
- 1750362..1750427 + 66 NuclAT_45 - -
- 1750362..1750427 + 66 NuclAT_45 - -
- 1750362..1750427 + 66 NuclAT_45 - -
- 1750362..1750429 + 68 NuclAT_16 - -
- 1750362..1750429 + 68 NuclAT_16 - -
- 1750362..1750429 + 68 NuclAT_16 - -
- 1750362..1750429 + 68 NuclAT_16 - -
- 1750362..1750429 + 68 NuclAT_18 - -
- 1750362..1750429 + 68 NuclAT_18 - -
- 1750362..1750429 + 68 NuclAT_18 - -
- 1750362..1750429 + 68 NuclAT_18 - -
- 1750362..1750429 + 68 NuclAT_20 - -
- 1750362..1750429 + 68 NuclAT_20 - -
- 1750362..1750429 + 68 NuclAT_20 - -
- 1750362..1750429 + 68 NuclAT_20 - -
- 1750362..1750429 + 68 NuclAT_22 - -
- 1750362..1750429 + 68 NuclAT_22 - -
- 1750362..1750429 + 68 NuclAT_22 - -
- 1750362..1750429 + 68 NuclAT_22 - -
- 1750362..1750429 + 68 NuclAT_24 - -
- 1750362..1750429 + 68 NuclAT_24 - -
- 1750362..1750429 + 68 NuclAT_24 - -
- 1750362..1750429 + 68 NuclAT_24 - -
- 1750362..1750429 + 68 NuclAT_26 - -
- 1750362..1750429 + 68 NuclAT_26 - -
- 1750362..1750429 + 68 NuclAT_26 - -
- 1750362..1750429 + 68 NuclAT_26 - -
I3U_RS10995 1750719..1751819 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
I3U_RS11000 1752089..1752319 + 231 WP_001146442.1 putative cation transport regulator ChaB -
I3U_RS11005 1752477..1753172 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
I3U_RS11010 1753216..1753569 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T100633 WP_000170954.1 NZ_CP028126:c1749243-1749136 [Escherichia coli O26 str. RM10386]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T100633 NZ_CP028126:c1749243-1749136 [Escherichia coli O26 str. RM10386]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT100633 NZ_CP028126:1749293-1749356 [Escherichia coli O26 str. RM10386]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References