Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 1357076..1357298 Replicon chromosome
Accession NZ_CP028122
Organism Escherichia coli O43 str. RM10042

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag I3W_RS08215 Protein ID WP_000170965.1
Coordinates 1357076..1357183 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 1357231..1357298 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I3W_RS08180 1352931..1353764 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
I3W_RS08185 1353761..1354153 + 393 WP_000200392.1 invasion regulator SirB2 -
I3W_RS08190 1354157..1354966 + 810 WP_001257044.1 invasion regulator SirB1 -
I3W_RS08195 1355002..1355856 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I3W_RS08200 1356005..1356112 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1356160..1356226 + 67 NuclAT_25 - -
- 1356160..1356226 + 67 NuclAT_25 - -
- 1356160..1356226 + 67 NuclAT_25 - -
- 1356160..1356226 + 67 NuclAT_25 - -
- 1356160..1356226 + 67 NuclAT_27 - -
- 1356160..1356226 + 67 NuclAT_27 - -
- 1356160..1356226 + 67 NuclAT_27 - -
- 1356160..1356226 + 67 NuclAT_27 - -
- 1356160..1356226 + 67 NuclAT_29 - -
- 1356160..1356226 + 67 NuclAT_29 - -
- 1356160..1356226 + 67 NuclAT_29 - -
- 1356160..1356226 + 67 NuclAT_29 - -
- 1356160..1356226 + 67 NuclAT_31 - -
- 1356160..1356226 + 67 NuclAT_31 - -
- 1356160..1356226 + 67 NuclAT_31 - -
- 1356160..1356226 + 67 NuclAT_31 - -
- 1356160..1356226 + 67 NuclAT_33 - -
- 1356160..1356226 + 67 NuclAT_33 - -
- 1356160..1356226 + 67 NuclAT_33 - -
- 1356160..1356226 + 67 NuclAT_33 - -
- 1356160..1356226 + 67 NuclAT_35 - -
- 1356160..1356226 + 67 NuclAT_35 - -
- 1356160..1356226 + 67 NuclAT_35 - -
- 1356160..1356226 + 67 NuclAT_35 - -
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_42 - -
- 1356162..1356225 + 64 NuclAT_42 - -
- 1356162..1356225 + 64 NuclAT_42 - -
- 1356162..1356225 + 64 NuclAT_42 - -
I3W_RS08205 1356540..1356647 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_24 - -
- 1356700..1356763 + 64 NuclAT_24 - -
- 1356700..1356763 + 64 NuclAT_24 - -
- 1356700..1356763 + 64 NuclAT_24 - -
I3W_RS08215 1357076..1357183 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1357231..1357298 + 68 NuclAT_13 - Antitoxin
- 1357231..1357298 + 68 NuclAT_13 - Antitoxin
- 1357231..1357298 + 68 NuclAT_13 - Antitoxin
- 1357231..1357298 + 68 NuclAT_13 - Antitoxin
- 1357231..1357298 + 68 NuclAT_15 - Antitoxin
- 1357231..1357298 + 68 NuclAT_15 - Antitoxin
- 1357231..1357298 + 68 NuclAT_15 - Antitoxin
- 1357231..1357298 + 68 NuclAT_15 - Antitoxin
- 1357231..1357298 + 68 NuclAT_17 - Antitoxin
- 1357231..1357298 + 68 NuclAT_17 - Antitoxin
- 1357231..1357298 + 68 NuclAT_17 - Antitoxin
- 1357231..1357298 + 68 NuclAT_17 - Antitoxin
- 1357231..1357298 + 68 NuclAT_19 - Antitoxin
- 1357231..1357298 + 68 NuclAT_19 - Antitoxin
- 1357231..1357298 + 68 NuclAT_19 - Antitoxin
- 1357231..1357298 + 68 NuclAT_19 - Antitoxin
- 1357231..1357298 + 68 NuclAT_21 - Antitoxin
- 1357231..1357298 + 68 NuclAT_21 - Antitoxin
- 1357231..1357298 + 68 NuclAT_21 - Antitoxin
- 1357231..1357298 + 68 NuclAT_21 - Antitoxin
- 1357231..1357298 + 68 NuclAT_23 - Antitoxin
- 1357231..1357298 + 68 NuclAT_23 - Antitoxin
- 1357231..1357298 + 68 NuclAT_23 - Antitoxin
- 1357231..1357298 + 68 NuclAT_23 - Antitoxin
I3W_RS08220 1357588..1358688 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
I3W_RS08225 1358958..1359188 + 231 Protein_1271 putative cation transport regulator ChaB -
I3W_RS08230 1359346..1360041 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
I3W_RS08235 1360085..1360438 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -
I3W_RS08240 1360623..1362017 + 1395 Protein_1274 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T100601 WP_000170965.1 NZ_CP028122:c1357183-1357076 [Escherichia coli O43 str. RM10042]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T100601 NZ_CP028122:c1357183-1357076 [Escherichia coli O43 str. RM10042]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT100601 NZ_CP028122:1357231-1357298 [Escherichia coli O43 str. RM10042]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References