Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1356005..1356226 Replicon chromosome
Accession NZ_CP028122
Organism Escherichia coli O43 str. RM10042

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag I3W_RS08200 Protein ID WP_000170954.1
Coordinates 1356005..1356112 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1356160..1356226 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I3W_RS08175 1351849..1352931 + 1083 WP_000804726.1 peptide chain release factor 1 -
I3W_RS08180 1352931..1353764 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
I3W_RS08185 1353761..1354153 + 393 WP_000200392.1 invasion regulator SirB2 -
I3W_RS08190 1354157..1354966 + 810 WP_001257044.1 invasion regulator SirB1 -
I3W_RS08195 1355002..1355856 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I3W_RS08200 1356005..1356112 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1356160..1356226 + 67 NuclAT_25 - Antitoxin
- 1356160..1356226 + 67 NuclAT_25 - Antitoxin
- 1356160..1356226 + 67 NuclAT_25 - Antitoxin
- 1356160..1356226 + 67 NuclAT_25 - Antitoxin
- 1356160..1356226 + 67 NuclAT_27 - Antitoxin
- 1356160..1356226 + 67 NuclAT_27 - Antitoxin
- 1356160..1356226 + 67 NuclAT_27 - Antitoxin
- 1356160..1356226 + 67 NuclAT_27 - Antitoxin
- 1356160..1356226 + 67 NuclAT_29 - Antitoxin
- 1356160..1356226 + 67 NuclAT_29 - Antitoxin
- 1356160..1356226 + 67 NuclAT_29 - Antitoxin
- 1356160..1356226 + 67 NuclAT_29 - Antitoxin
- 1356160..1356226 + 67 NuclAT_31 - Antitoxin
- 1356160..1356226 + 67 NuclAT_31 - Antitoxin
- 1356160..1356226 + 67 NuclAT_31 - Antitoxin
- 1356160..1356226 + 67 NuclAT_31 - Antitoxin
- 1356160..1356226 + 67 NuclAT_33 - Antitoxin
- 1356160..1356226 + 67 NuclAT_33 - Antitoxin
- 1356160..1356226 + 67 NuclAT_33 - Antitoxin
- 1356160..1356226 + 67 NuclAT_33 - Antitoxin
- 1356160..1356226 + 67 NuclAT_35 - Antitoxin
- 1356160..1356226 + 67 NuclAT_35 - Antitoxin
- 1356160..1356226 + 67 NuclAT_35 - Antitoxin
- 1356160..1356226 + 67 NuclAT_35 - Antitoxin
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_38 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_40 - -
- 1356162..1356225 + 64 NuclAT_42 - -
- 1356162..1356225 + 64 NuclAT_42 - -
- 1356162..1356225 + 64 NuclAT_42 - -
- 1356162..1356225 + 64 NuclAT_42 - -
I3W_RS08205 1356540..1356647 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_37 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_39 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356761 + 62 NuclAT_41 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_26 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_28 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_30 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_32 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_34 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356762 + 63 NuclAT_36 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_14 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_16 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_18 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_20 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_22 - -
- 1356700..1356763 + 64 NuclAT_24 - -
- 1356700..1356763 + 64 NuclAT_24 - -
- 1356700..1356763 + 64 NuclAT_24 - -
- 1356700..1356763 + 64 NuclAT_24 - -
I3W_RS08215 1357076..1357183 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1357231..1357298 + 68 NuclAT_13 - -
- 1357231..1357298 + 68 NuclAT_13 - -
- 1357231..1357298 + 68 NuclAT_13 - -
- 1357231..1357298 + 68 NuclAT_13 - -
- 1357231..1357298 + 68 NuclAT_15 - -
- 1357231..1357298 + 68 NuclAT_15 - -
- 1357231..1357298 + 68 NuclAT_15 - -
- 1357231..1357298 + 68 NuclAT_15 - -
- 1357231..1357298 + 68 NuclAT_17 - -
- 1357231..1357298 + 68 NuclAT_17 - -
- 1357231..1357298 + 68 NuclAT_17 - -
- 1357231..1357298 + 68 NuclAT_17 - -
- 1357231..1357298 + 68 NuclAT_19 - -
- 1357231..1357298 + 68 NuclAT_19 - -
- 1357231..1357298 + 68 NuclAT_19 - -
- 1357231..1357298 + 68 NuclAT_19 - -
- 1357231..1357298 + 68 NuclAT_21 - -
- 1357231..1357298 + 68 NuclAT_21 - -
- 1357231..1357298 + 68 NuclAT_21 - -
- 1357231..1357298 + 68 NuclAT_21 - -
- 1357231..1357298 + 68 NuclAT_23 - -
- 1357231..1357298 + 68 NuclAT_23 - -
- 1357231..1357298 + 68 NuclAT_23 - -
- 1357231..1357298 + 68 NuclAT_23 - -
I3W_RS08220 1357588..1358688 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
I3W_RS08225 1358958..1359188 + 231 Protein_1271 putative cation transport regulator ChaB -
I3W_RS08230 1359346..1360041 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
I3W_RS08235 1360085..1360438 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T100599 WP_000170954.1 NZ_CP028122:c1356112-1356005 [Escherichia coli O43 str. RM10042]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T100599 NZ_CP028122:c1356112-1356005 [Escherichia coli O43 str. RM10042]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT100599 NZ_CP028122:1356160-1356226 [Escherichia coli O43 str. RM10042]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References