Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 5996..6422 | Replicon | plasmid pRM9322-1 |
Accession | NZ_CP028118 | ||
Organism | Escherichia coli O111 str. RM9322 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | I3O_RS27595 | Protein ID | WP_001312861.1 |
Coordinates | 5996..6154 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 6198..6422 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I3O_RS27555 | 1366..2055 | - | 690 | WP_000283394.1 | conjugal transfer transcriptional regulator TraJ | - |
I3O_RS27560 | 2242..2625 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
I3O_RS27565 | 3039..3548 | + | 510 | Protein_6 | transglycosylase SLT domain-containing protein | - |
I3O_RS27570 | 3845..4666 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
I3O_RS27575 | 4787..5074 | - | 288 | WP_000107535.1 | hypothetical protein | - |
I3O_RS27595 | 5996..6154 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 6198..6422 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 6198..6422 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 6198..6422 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 6198..6422 | - | 225 | NuclAT_0 | - | Antitoxin |
I3O_RS28440 | 6234..6422 | + | 189 | WP_001299721.1 | hypothetical protein | - |
I3O_RS27600 | 6434..7153 | - | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
I3O_RS27605 | 7150..7584 | - | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
I3O_RS27610 | 7639..9597 | - | 1959 | WP_001145472.1 | ParB/RepB/Spo0J family partition protein | - |
I3O_RS27615 | 9656..9889 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
I3O_RS27620 | 9945..10472 | - | 528 | WP_000290792.1 | single-stranded DNA-binding protein | - |
I3O_RS28445 | 10945..11241 | - | 297 | WP_077694982.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | espP / hlyD / hlyB / hlyA / hlyC | 1..78469 | 78469 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T100586 WP_001312861.1 NZ_CP028118:c6154-5996 [Escherichia coli O111 str. RM9322]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T100586 NZ_CP028118:c6154-5996 [Escherichia coli O111 str. RM9322]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT100586 NZ_CP028118:c6422-6198 [Escherichia coli O111 str. RM9322]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|