Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1700020..1700240 Replicon chromosome
Accession NZ_CP028116
Organism Escherichia coli O26 str. RM8426

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag I3M_RS10075 Protein ID WP_000170954.1
Coordinates 1700020..1700127 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1700177..1700240 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I3M_RS10050 1695864..1696946 + 1083 WP_000804726.1 peptide chain release factor 1 -
I3M_RS10055 1696946..1697779 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
I3M_RS10060 1697776..1698168 + 393 WP_000200378.1 invasion regulator SirB2 -
I3M_RS10065 1698172..1698981 + 810 WP_001257045.1 invasion regulator SirB1 -
I3M_RS10070 1699017..1699871 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I3M_RS10075 1700020..1700127 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1700177..1700240 + 64 NuclAT_32 - Antitoxin
- 1700177..1700240 + 64 NuclAT_32 - Antitoxin
- 1700177..1700240 + 64 NuclAT_32 - Antitoxin
- 1700177..1700240 + 64 NuclAT_32 - Antitoxin
- 1700177..1700240 + 64 NuclAT_35 - Antitoxin
- 1700177..1700240 + 64 NuclAT_35 - Antitoxin
- 1700177..1700240 + 64 NuclAT_35 - Antitoxin
- 1700177..1700240 + 64 NuclAT_35 - Antitoxin
- 1700177..1700240 + 64 NuclAT_38 - Antitoxin
- 1700177..1700240 + 64 NuclAT_38 - Antitoxin
- 1700177..1700240 + 64 NuclAT_38 - Antitoxin
- 1700177..1700240 + 64 NuclAT_38 - Antitoxin
- 1700177..1700240 + 64 NuclAT_41 - Antitoxin
- 1700177..1700240 + 64 NuclAT_41 - Antitoxin
- 1700177..1700240 + 64 NuclAT_41 - Antitoxin
- 1700177..1700240 + 64 NuclAT_41 - Antitoxin
- 1700177..1700240 + 64 NuclAT_44 - Antitoxin
- 1700177..1700240 + 64 NuclAT_44 - Antitoxin
- 1700177..1700240 + 64 NuclAT_44 - Antitoxin
- 1700177..1700240 + 64 NuclAT_44 - Antitoxin
- 1700177..1700240 + 64 NuclAT_47 - Antitoxin
- 1700177..1700240 + 64 NuclAT_47 - Antitoxin
- 1700177..1700240 + 64 NuclAT_47 - Antitoxin
- 1700177..1700240 + 64 NuclAT_47 - Antitoxin
I3M_RS31800 1700555..1700662 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1700715..1700776 + 62 NuclAT_31 - -
- 1700715..1700776 + 62 NuclAT_31 - -
- 1700715..1700776 + 62 NuclAT_31 - -
- 1700715..1700776 + 62 NuclAT_31 - -
- 1700715..1700776 + 62 NuclAT_34 - -
- 1700715..1700776 + 62 NuclAT_34 - -
- 1700715..1700776 + 62 NuclAT_34 - -
- 1700715..1700776 + 62 NuclAT_34 - -
- 1700715..1700776 + 62 NuclAT_37 - -
- 1700715..1700776 + 62 NuclAT_37 - -
- 1700715..1700776 + 62 NuclAT_37 - -
- 1700715..1700776 + 62 NuclAT_37 - -
- 1700715..1700776 + 62 NuclAT_40 - -
- 1700715..1700776 + 62 NuclAT_40 - -
- 1700715..1700776 + 62 NuclAT_40 - -
- 1700715..1700776 + 62 NuclAT_40 - -
- 1700715..1700776 + 62 NuclAT_43 - -
- 1700715..1700776 + 62 NuclAT_43 - -
- 1700715..1700776 + 62 NuclAT_43 - -
- 1700715..1700776 + 62 NuclAT_43 - -
- 1700715..1700776 + 62 NuclAT_46 - -
- 1700715..1700776 + 62 NuclAT_46 - -
- 1700715..1700776 + 62 NuclAT_46 - -
- 1700715..1700776 + 62 NuclAT_46 - -
- 1700715..1700778 + 64 NuclAT_17 - -
- 1700715..1700778 + 64 NuclAT_17 - -
- 1700715..1700778 + 64 NuclAT_17 - -
- 1700715..1700778 + 64 NuclAT_17 - -
- 1700715..1700778 + 64 NuclAT_19 - -
- 1700715..1700778 + 64 NuclAT_19 - -
- 1700715..1700778 + 64 NuclAT_19 - -
- 1700715..1700778 + 64 NuclAT_19 - -
- 1700715..1700778 + 64 NuclAT_21 - -
- 1700715..1700778 + 64 NuclAT_21 - -
- 1700715..1700778 + 64 NuclAT_21 - -
- 1700715..1700778 + 64 NuclAT_21 - -
- 1700715..1700778 + 64 NuclAT_23 - -
- 1700715..1700778 + 64 NuclAT_23 - -
- 1700715..1700778 + 64 NuclAT_23 - -
- 1700715..1700778 + 64 NuclAT_23 - -
- 1700715..1700778 + 64 NuclAT_25 - -
- 1700715..1700778 + 64 NuclAT_25 - -
- 1700715..1700778 + 64 NuclAT_25 - -
- 1700715..1700778 + 64 NuclAT_25 - -
- 1700715..1700778 + 64 NuclAT_27 - -
- 1700715..1700778 + 64 NuclAT_27 - -
- 1700715..1700778 + 64 NuclAT_27 - -
- 1700715..1700778 + 64 NuclAT_27 - -
I3M_RS10090 1701091..1701198 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1701246..1701311 + 66 NuclAT_30 - -
- 1701246..1701311 + 66 NuclAT_30 - -
- 1701246..1701311 + 66 NuclAT_30 - -
- 1701246..1701311 + 66 NuclAT_30 - -
- 1701246..1701311 + 66 NuclAT_33 - -
- 1701246..1701311 + 66 NuclAT_33 - -
- 1701246..1701311 + 66 NuclAT_33 - -
- 1701246..1701311 + 66 NuclAT_33 - -
- 1701246..1701311 + 66 NuclAT_36 - -
- 1701246..1701311 + 66 NuclAT_36 - -
- 1701246..1701311 + 66 NuclAT_36 - -
- 1701246..1701311 + 66 NuclAT_36 - -
- 1701246..1701311 + 66 NuclAT_39 - -
- 1701246..1701311 + 66 NuclAT_39 - -
- 1701246..1701311 + 66 NuclAT_39 - -
- 1701246..1701311 + 66 NuclAT_39 - -
- 1701246..1701311 + 66 NuclAT_42 - -
- 1701246..1701311 + 66 NuclAT_42 - -
- 1701246..1701311 + 66 NuclAT_42 - -
- 1701246..1701311 + 66 NuclAT_42 - -
- 1701246..1701311 + 66 NuclAT_45 - -
- 1701246..1701311 + 66 NuclAT_45 - -
- 1701246..1701311 + 66 NuclAT_45 - -
- 1701246..1701311 + 66 NuclAT_45 - -
- 1701246..1701313 + 68 NuclAT_16 - -
- 1701246..1701313 + 68 NuclAT_16 - -
- 1701246..1701313 + 68 NuclAT_16 - -
- 1701246..1701313 + 68 NuclAT_16 - -
- 1701246..1701313 + 68 NuclAT_18 - -
- 1701246..1701313 + 68 NuclAT_18 - -
- 1701246..1701313 + 68 NuclAT_18 - -
- 1701246..1701313 + 68 NuclAT_18 - -
- 1701246..1701313 + 68 NuclAT_20 - -
- 1701246..1701313 + 68 NuclAT_20 - -
- 1701246..1701313 + 68 NuclAT_20 - -
- 1701246..1701313 + 68 NuclAT_20 - -
- 1701246..1701313 + 68 NuclAT_22 - -
- 1701246..1701313 + 68 NuclAT_22 - -
- 1701246..1701313 + 68 NuclAT_22 - -
- 1701246..1701313 + 68 NuclAT_22 - -
- 1701246..1701313 + 68 NuclAT_24 - -
- 1701246..1701313 + 68 NuclAT_24 - -
- 1701246..1701313 + 68 NuclAT_24 - -
- 1701246..1701313 + 68 NuclAT_24 - -
- 1701246..1701313 + 68 NuclAT_26 - -
- 1701246..1701313 + 68 NuclAT_26 - -
- 1701246..1701313 + 68 NuclAT_26 - -
- 1701246..1701313 + 68 NuclAT_26 - -
I3M_RS10095 1701603..1702703 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
I3M_RS10100 1702973..1703203 + 231 WP_001146442.1 putative cation transport regulator ChaB -
I3M_RS10105 1703361..1704056 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
I3M_RS10110 1704100..1704453 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T100526 WP_000170954.1 NZ_CP028116:c1700127-1700020 [Escherichia coli O26 str. RM8426]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T100526 NZ_CP028116:c1700127-1700020 [Escherichia coli O26 str. RM8426]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT100526 NZ_CP028116:1700177-1700240 [Escherichia coli O26 str. RM8426]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References