Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 1210755..1210902 | Replicon | chromosome |
Accession | NZ_CP027846 | ||
Organism | Staphylococcus kloosii strain ATCC 43959 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | C7J89_RS05915 | Protein ID | WP_106884395.1 |
Coordinates | 1210755..1210850 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1210873..1210902 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7J89_RS05895 | 1206249..1207628 | - | 1380 | WP_103295285.1 | aldehyde dehydrogenase | - |
C7J89_RS05900 | 1207735..1208661 | - | 927 | WP_103295284.1 | manganese-dependent inorganic pyrophosphatase | - |
C7J89_RS05905 | 1208709..1209269 | - | 561 | WP_103295283.1 | cysteine hydrolase family protein | - |
C7J89_RS05910 | 1209411..1210493 | + | 1083 | WP_103295282.1 | right-handed parallel beta-helix repeat-containing protein | - |
C7J89_RS05915 | 1210755..1210850 | + | 96 | WP_106884395.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1210873..1210902 | + | 30 | - | - | Antitoxin |
C7J89_RS05920 | 1211049..1211852 | - | 804 | WP_103295281.1 | prephenate dehydratase | - |
C7J89_RS05925 | 1211884..1212948 | - | 1065 | WP_103295280.1 | nitric oxide synthase oxygenase | - |
C7J89_RS05930 | 1213128..1214597 | + | 1470 | WP_103295279.1 | nicotinate phosphoribosyltransferase | - |
C7J89_RS05935 | 1214590..1215411 | + | 822 | WP_103295278.1 | ammonia-dependent NAD(+) synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3669.38 Da Isoelectric Point: 8.0615
>T100368 WP_106884395.1 NZ_CP027846:1210755-1210850 [Staphylococcus kloosii]
MLDFLVHNMTLVINGCIIALFAHWLRNRNDK
MLDFLVHNMTLVINGCIIALFAHWLRNRNDK
Download Length: 96 bp
>T100368 NZ_CP027846:1210755-1210850 [Staphylococcus kloosii]
ATGTTGGATTTCCTTGTTCACAATATGACTTTAGTCATCAATGGTTGTATTATTGCGTTATTTGCGCATTGGCTGCGTAA
TCGCAATGACAAATAG
ATGTTGGATTTCCTTGTTCACAATATGACTTTAGTCATCAATGGTTGTATTATTGCGTTATTTGCGCATTGGCTGCGTAA
TCGCAATGACAAATAG
Antitoxin
Download Length: 30 bp
>AT100368 NZ_CP027846:1210873-1210902 [Staphylococcus kloosii]
AATCCCCTCACTATTTGCGGTAGTGAGGGG
AATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|