Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 83642..84068 | Replicon | plasmid pVH1-2-KPC |
Accession | NZ_CP027802 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain VH1-2 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | C7K65_RS27535 | Protein ID | WP_001372321.1 |
Coordinates | 83642..83767 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 83844..84068 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7K65_RS27500 (78665) | 78665..78892 | - | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
C7K65_RS27505 (79029) | 79029..79700 | - | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
C7K65_RS27510 (79894) | 79894..80277 | - | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
C7K65_RS27515 (80612) | 80612..81202 | + | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
C7K65_RS27520 (81499) | 81499..82320 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
C7K65_RS27525 (82431) | 82431..82727 | - | 297 | WP_001272251.1 | hypothetical protein | - |
C7K65_RS27530 (83027) | 83027..83323 | + | 297 | Protein_100 | hypothetical protein | - |
C7K65_RS27535 (83642) | 83642..83767 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C7K65_RS27540 (83709) | 83709..83858 | - | 150 | Protein_102 | plasmid maintenance protein Mok | - |
- (83844) | 83844..84068 | - | 225 | NuclAT_0 | - | Antitoxin |
- (83844) | 83844..84068 | - | 225 | NuclAT_0 | - | Antitoxin |
- (83844) | 83844..84068 | - | 225 | NuclAT_0 | - | Antitoxin |
- (83844) | 83844..84068 | - | 225 | NuclAT_0 | - | Antitoxin |
C7K65_RS27545 (84080) | 84080..84799 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
C7K65_RS27550 (84796) | 84796..85230 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
C7K65_RS27555 (85299) | 85299..87322 | - | 2024 | Protein_105 | ParB/RepB/Spo0J family partition protein | - |
C7K65_RS27560 (87383) | 87383..87616 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
C7K65_RS27565 (87674) | 87674..88201 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
C7K65_RS27570 (88503) | 88503..88952 | + | 450 | Protein_108 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | cmlA1 / blaTEM-1B / blaKPC-2 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..128932 | 128932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T100352 WP_001372321.1 NZ_CP027802:c83767-83642 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T100352 NZ_CP027802:c83767-83642 [Klebsiella pneumoniae subsp. pneumoniae]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT100352 NZ_CP027802:c84068-83844 [Klebsiella pneumoniae subsp. pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|