Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 42469..42722 Replicon plasmid pVH1-2-KPC
Accession NZ_CP027802
Organism Klebsiella pneumoniae subsp. pneumoniae strain VH1-2

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag C7K65_RS27290 Protein ID WP_001312851.1
Coordinates 42469..42618 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 42663..42722 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C7K65_RS27260 (38491) 38491..38892 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
C7K65_RS27265 (38825) 38825..39082 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
C7K65_RS27270 (39175) 39175..39828 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
C7K65_RS27275 (40767) 40767..41624 - 858 WP_016240488.1 incFII family plasmid replication initiator RepA -
C7K65_RS27280 (41617) 41617..41691 - 75 WP_001365705.1 RepA leader peptide Tap -
C7K65_RS27285 (41936) 41936..42184 - 249 WP_000083839.1 replication regulatory protein RepA -
C7K65_RS27290 (42469) 42469..42618 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (42663) 42663..42722 + 60 NuclAT_1 - Antitoxin
- (42663) 42663..42722 + 60 NuclAT_1 - Antitoxin
- (42663) 42663..42722 + 60 NuclAT_1 - Antitoxin
- (42663) 42663..42722 + 60 NuclAT_1 - Antitoxin
C7K65_RS27295 (42865) 42865..43338 - 474 WP_016240489.1 hypothetical protein -
C7K65_RS27300 (43493) 43493..44083 - 591 WP_033807967.1 DUF2726 domain-containing protein -
C7K65_RS27305 (44121) 44121..44330 - 210 WP_001298565.1 hemolysin expression modulator Hha -
C7K65_RS27310 (44376) 44376..44837 - 462 WP_001233838.1 thermonuclease family protein -
C7K65_RS27315 (45082) 45082..45294 - 213 WP_001309245.1 ANR family transcriptional regulator -
C7K65_RS27320 (45423) 45423..45983 - 561 WP_000139321.1 fertility inhibition protein FinO -
C7K65_RS27325 (46086) 46086..46946 - 861 WP_000704523.1 alpha/beta hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cmlA1 / blaTEM-1B / blaKPC-2 / sitABCD iutA / iucD / iucC / iucB / iucA 1..128932 128932
- inside IScluster/Tn cmlA1 / blaTEM-1B / blaKPC-2 - 97..38160 38063


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T100348 WP_001312851.1 NZ_CP027802:c42618-42469 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T100348 NZ_CP027802:c42618-42469 [Klebsiella pneumoniae subsp. pneumoniae]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT100348 NZ_CP027802:42663-42722 [Klebsiella pneumoniae subsp. pneumoniae]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References