Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2114915..2115214 | Replicon | chromosome |
Accession | NZ_CP027788 | ||
Organism | Staphylococcus aureus strain CMRSA-6 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | C7M55_RS11065 | Protein ID | WP_072482930.1 |
Coordinates | 2115038..2115214 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2114915..2114970 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7M55_RS11010 | 2110473..2110652 | + | 180 | WP_000669789.1 | hypothetical protein | - |
C7M55_RS11020 | 2110963..2111223 | + | 261 | WP_001791826.1 | hypothetical protein | - |
C7M55_RS11025 | 2111276..2111626 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
C7M55_RS11030 | 2112136..2112471 | - | 336 | Protein_2033 | SH3 domain-containing protein | - |
C7M55_RS11045 | 2113123..2113614 | - | 492 | WP_000920041.1 | staphylokinase | - |
C7M55_RS11050 | 2113805..2114560 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
C7M55_RS11055 | 2114572..2114826 | - | 255 | WP_000611512.1 | phage holin | - |
C7M55_RS11060 | 2114878..2114985 | + | 108 | Protein_2037 | hypothetical protein | - |
- | 2114907..2115046 | + | 140 | NuclAT_0 | - | - |
- | 2114907..2115046 | + | 140 | NuclAT_0 | - | - |
- | 2114907..2115046 | + | 140 | NuclAT_0 | - | - |
- | 2114907..2115046 | + | 140 | NuclAT_0 | - | - |
- | 2114915..2114970 | + | 56 | - | - | Antitoxin |
C7M55_RS11065 | 2115038..2115214 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
C7M55_RS11070 | 2115323..2116096 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
C7M55_RS11075 | 2116469..2116843 | - | 375 | WP_000340977.1 | hypothetical protein | - |
C7M55_RS11080 | 2116899..2117186 | - | 288 | WP_001262621.1 | hypothetical protein | - |
C7M55_RS11085 | 2117232..2117384 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2111276..2168801 | 57525 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T100311 WP_072482930.1 NZ_CP027788:c2115214-2115038 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T100311 NZ_CP027788:c2115214-2115038 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT100311 NZ_CP027788:2114915-2114970 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|