Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1954622..1954804 | Replicon | chromosome |
| Accession | NZ_CP027788 | ||
| Organism | Staphylococcus aureus strain CMRSA-6 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | C7M55_RS09985 | Protein ID | WP_001801861.1 |
| Coordinates | 1954622..1954717 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1954745..1954804 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M55_RS09935 | 1950282..1950908 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| C7M55_RS09940 | 1950949..1951293 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| C7M55_RS09945 | 1951391..1951942 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| C7M55_RS09950 | 1952160..1952801 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C7M55_RS09955 | 1952915..1953100 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| C7M55_RS09960 | 1953102..1953278 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| C7M55_RS09965 | 1953289..1953672 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| C7M55_RS09975 | 1954276..1954419 | - | 144 | WP_001549059.1 | transposase | - |
| C7M55_RS09985 | 1954622..1954717 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1954745..1954804 | - | 60 | - | - | Antitoxin |
| C7M55_RS09990 | 1954840..1954941 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| C7M55_RS09995 | 1954919..1955095 | - | 177 | Protein_1880 | transposase | - |
| C7M55_RS10000 | 1955289..1955666 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| C7M55_RS10005 | 1956187..1957455 | - | 1269 | Protein_1882 | ATP-binding protein | - |
| C7M55_RS10015 | 1957507..1958678 | - | 1172 | Protein_1883 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1928584..1987973 | 59389 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T100308 WP_001801861.1 NZ_CP027788:1954622-1954717 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T100308 NZ_CP027788:1954622-1954717 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT100308 NZ_CP027788:c1954804-1954745 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|