Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 52342..52612 | Replicon | plasmid unnamed |
Accession | NZ_CP027767 | ||
Organism | Escherichia coli strain 2013C-3342 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C7M85_RS29915 | Protein ID | WP_001312861.1 |
Coordinates | 52454..52612 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 52342..52405 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C7M85_RS29870 | 47415..47663 | + | 249 | WP_071606928.1 | hypothetical protein | - |
C7M85_RS29890 | 48136..48663 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
C7M85_RS29895 | 48719..48952 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
C7M85_RS29900 | 49011..50969 | + | 1959 | WP_001145473.1 | ParB/RepB/Spo0J family partition protein | - |
C7M85_RS29905 | 51024..51458 | + | 435 | WP_044804925.1 | conjugation system SOS inhibitor PsiB | - |
C7M85_RS29910 | 51455..52174 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
C7M85_RS30420 | 52186..52374 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 52186..52410 | + | 225 | NuclAT_0 | - | - |
- | 52186..52410 | + | 225 | NuclAT_0 | - | - |
- | 52186..52410 | + | 225 | NuclAT_0 | - | - |
- | 52186..52410 | + | 225 | NuclAT_0 | - | - |
- | 52342..52405 | - | 64 | - | - | Antitoxin |
C7M85_RS29915 | 52454..52612 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C7M85_RS30655 | 53303..53509 | + | 207 | WP_000547971.1 | hypothetical protein | - |
C7M85_RS29935 | 53534..53821 | + | 288 | WP_000107535.1 | hypothetical protein | - |
C7M85_RS30660 | 53941..54024 | + | 84 | Protein_60 | DUF945 domain-containing protein | - |
C7M85_RS29945 | 54209..55396 | - | 1188 | WP_106884016.1 | IS91 family transposase | - |
C7M85_RS29955 | 55685..56665 | - | 981 | WP_000019402.1 | IS5-like element IS5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hlyC / hlyA / hlyB / hlyD / espP | 1..66545 | 66545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T100287 WP_001312861.1 NZ_CP027767:52454-52612 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T100287 NZ_CP027767:52454-52612 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT100287 NZ_CP027767:c52405-52342 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|