SecReT4
Protein ID: 218665728
T4SS name [ID]Tra_F [558]
Gene symbol-
Locus tagAFE_1096
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]987452..988702 [+]
Productconjugal transfer protein TraU
Component typeTraU_F
UniProt IDB7J844
KEGG IDafr:AFE_1096
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.4e-41, Aligned region: 43..319
TraU [PF06834], Evalue: 1.4e-41, Aligned region: 364..405
Protein Sequence: 416 a.a.     [Download]
>gi|218665728|ref|YP_002425568.1| conjugal transfer protein TraU [Acidithiobacillus ferrooxidans ATCC 23270]
MKLRNKIAGIAAALVLTFAVPALATGAQVATLCPDAGVFNELIGGVCWSALFPLRIAGMTWFGGNSGVPN
GASSGFMCECGGSWSHLQLPTVGVQIGYWQPTMLMEAVSHPFCSPVLGGVSLQPDSTVGSQWTGSWGGNV
GTGVSTGNKNSTFFNVHLWTFPLITMMQLANIPDCNTGYSGMNLMLMSEVFPTWNDDLLSFLASPEELLY
DNPIGLLGATEECAQESLGAQPIDDEYWTAGCWGLLYPMVGSNLGGNDPIQASNIDVARMIAMGFRLGFL
ERTMGNSTLCGPRRTYVLPKAQYRFQILFPNDETNQEPNASVTAPNVSAQPSGGSMPPANYVTPAASNQG
TLPQNGGVNIQAPPTQSGECTHWMGQTPFQWGEWDTQPATGGNYVYLVWQWTNCCLGLIGNQGPTG
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|218665024|ref|NC_011761.1|:987452-988702 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
TTGAAATTGCGCAATAAGATCGCTGGCATTGCCGCTGCGCTTGTCTTGACGTTTGCGGTTCCCGCTCTTG
CTACAGGTGCCCAGGTGGCTACCCTGTGTCCAGACGCGGGTGTTTTCAACGAACTGATCGGCGGTGTTTG
CTGGTCGGCGCTGTTCCCCTTGCGCATCGCCGGCATGACCTGGTTCGGTGGCAATTCCGGAGTGCCCAAT
GGCGCTTCTTCAGGGTTCATGTGTGAATGCGGCGGAAGCTGGTCACATCTGCAGCTCCCGACGGTGGGCG
TGCAAATCGGATACTGGCAACCGACCATGCTGATGGAGGCCGTGAGCCATCCTTTCTGTTCGCCCGTGCT
GGGTGGCGTGAGTCTGCAGCCCGATTCCACGGTCGGTTCACAATGGACGGGTTCCTGGGGCGGCAACGTC
GGCACCGGAGTTTCTACCGGCAACAAGAACAGCACTTTTTTCAACGTGCATTTGTGGACCTTCCCCCTGA
TTACCATGATGCAGTTGGCCAACATCCCCGACTGCAATACCGGGTATAGCGGCATGAACCTCATGCTCAT
GAGCGAAGTGTTTCCAACCTGGAACGACGATCTGTTGTCTTTCCTGGCAAGTCCGGAAGAACTGCTTTAT
GACAACCCGATTGGCTTGCTGGGCGCCACTGAGGAATGCGCGCAGGAATCCCTGGGGGCACAGCCTATCG
ACGATGAATATTGGACAGCGGGTTGCTGGGGGCTGCTCTACCCGATGGTTGGCAGCAATCTTGGGGGTAA
CGACCCGATTCAGGCTTCGAATATCGATGTCGCCCGCATGATCGCCATGGGCTTTCGCCTGGGATTTCTG
GAACGGACGATGGGCAACAGCACGCTTTGCGGCCCACGCCGCACGTATGTGCTGCCCAAGGCGCAATACC
GCTTCCAGATTCTGTTTCCCAATGACGAGACCAATCAGGAGCCCAACGCCAGCGTCACGGCGCCCAATGT
CAGCGCCCAGCCGTCGGGAGGTAGCATGCCGCCGGCGAATTATGTGACGCCTGCGGCCAGCAATCAGGGT
ACGTTGCCGCAGAACGGCGGCGTGAATATTCAGGCCCCGCCAACCCAGTCCGGGGAATGTACGCATTGGA
TGGGGCAGACCCCGTTCCAGTGGGGAGAATGGGATACGCAACCAGCTACCGGAGGAAATTATGTGTATCT
GGTCTGGCAATGGACTAACTGTTGCCTGGGGCTGATCGGCAATCAGGGGCCGACGGGGTAA