SecReT4
Protein ID: 189184828
T4SS name [ID]Tra_F [560]
Gene symbol-
Locus tagOTT_1921
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1954901..1955236 [+]
Productconjugative transfer protein TraG
Component typeTraG_F
UniProt IDB3CQA2
KEGG IDott:OTT_0857, ott:OTT_1488, ott:OTT_1373, ott:OTT_0205, ott:OTT_1921, ott:OTT_0340, ott:OTT_1141
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 7.1e-19, Aligned region: 5..103
Protein Sequence: 111 a.a.     [Download]
>gi|189184828|ref|YP_001938613.1| conjugative transfer protein TraG [Orientia tsutsugamushi str. Ikeda]
MDYVIYTFGGGDLLWHVFNGIGRVFASNSEYFTPVGHLALTIGGIWAATRAIFRGNIGIFAMEWFFPSIF
IFTLLFAPKATVWLKDEVSMSAPVKVDNIPCMIKISEIAIK
 
Nucleotide Sequence: 336 bp     [Download]
>gi|189182907|ref|NC_010793.1|:1954901-1955236 Orientia tsutsugamushi str. Ikeda, complete genome
ATGGATTACGTAATATACACATTTGGTGGTGGAGACTTATTGTGGCATGTGTTTAACGGCATAGGCAGAG
TCTTTGCTTCAAATAGCGAATACTTCACTCCAGTGGGCCACTTGGCCTTAACTATTGGTGGCATATGGGC
TGCGACTAGGGCTATTTTTAGAGGAAATATCGGCATCTTTGCTATGGAATGGTTTTTTCCGTCGATATTT
ATTTTTACGCTGTTATTTGCTCCAAAAGCCACTGTTTGGCTTAAGGATGAGGTATCAATGAGTGCGCCAG
TTAAAGTTGATAATATTCCTTGTATGATAAAAATAAGTGAAATTGCAATAAAATAA