SecReT4
Protein ID: 145597277
T4SS name [ID]Tra_F [118]
Gene symbol-
Locus tagYPDSF_4113
StrainYersinia pestis Pestoides F
Repliconplasmid MT [GenBank: NC_009378] [Browse all T4SS(s) in this replicon]
Location [Strand]93433..94080 [-]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDA4TSY9
KEGG IDypp:YPDSF_4113
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 2.5e-10, Aligned region: 1..30
Protein Sequence: 215 a.a.     [Download]
>gi|145597277|ref|YP_001154747.1| conjugal transfer pilus assembly protein TraW [Yersinia pestis Pestoides F]
MRALALGLALLTGSVTAADLGTWGDLWPVAEPDMLTVIESRLQTLAQSGEMDKKMAEFKARVVRNSQRPP
AVEGITRAVRYERRWFDPSVRVDKALADDKGNVFAQAGQVFNPLDVVPFNETLLFINGDDADQLAWVQRQ
KPDTLITRIILVQGNIPQTSEKLDSRIFFDQNGVLTTRFGISQVPARVTAAPSGKRLQVEIIPPDMAQHD
AGGVR
 
Nucleotide Sequence: 648 bp     [Download]
>ref|NC_009378.1|:c94080-93433 conjugal transfer pilus assembly protein TraW [Yersinia pestis Pestoides F]
ATGCGCGCCCTTGCCCTGGGCCTGGCGCTGCTGACCGGCAGCGTGACGGCCGCTGACCTCGGGACGTGGG
GCGATCTCTGGCCGGTGGCGGAGCCGGATATGCTGACCGTTATCGAAAGCCGGCTGCAGACGCTGGCGCA
GTCCGGCGAGATGGACAAAAAGATGGCGGAGTTTAAGGCGCGCGTGGTGCGCAACAGCCAGCGCCCGCCT
GCCGTTGAGGGAATAACCCGCGCGGTGCGCTACGAGCGGCGCTGGTTTGATCCGAGCGTGCGGGTGGACA
AGGCGCTTGCCGACGACAAGGGCAACGTGTTTGCTCAGGCGGGGCAGGTCTTTAATCCGCTTGATGTGGT
GCCGTTTAACGAAACGCTGCTGTTTATCAACGGCGACGATGCGGATCAGCTCGCGTGGGTACAGCGACAG
AAGCCTGACACCCTGATCACCCGCATCATTCTGGTGCAGGGAAATATTCCGCAGACGTCGGAGAAGCTCG
ACAGCCGCATTTTCTTCGACCAGAACGGGGTGCTGACCACCCGGTTCGGCATAAGCCAGGTACCGGCACG
GGTAACGGCGGCACCCAGCGGAAAGCGCCTGCAGGTGGAAATCATTCCGCCCGATATGGCGCAGCATGAC
GCAGGAGGTGTCCGGTGA