SecReT4
Protein ID: 113473816
T4SS name [ID]Tra_F [517]
Gene symboltraG
Locus tagpCAR3_138
StrainSphingomonas sp. KA1 plasmid pCAR3 (NC_008308)
Repliconplasmid pCAR3 [GenBank: NC_008308] [Browse all T4SS(s) in this replicon]
Location [Strand]139939..142980 [+]
Productsex pilus assembly and mating pair stabilization protein
Component typeTraG_F
UniProt IDQ0KJH5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.4e-113, Aligned region: 3..458
Protein Sequence: 1013 a.a.     [Download]
>gi|113473816|ref|YP_718079.1| sex pilus assembly and mating pair stabilization protein [Sphingomonas sp. KA1]
MLEVFTVGGGEYLVNTFNAIAAWTGSGGFKSVIRVVMVMGLIYALLVTAMDLDWRAWFRWFIQSTLIYLV
LMVPTVTVKVTDRVNPGLAPATVANVPIGLGVMASFTSQVSDYFTRTAETVFVMPAALNYSNGGFVYGAR
MWDKVRGFEIRNPVFKANLDGYLKQCAYYDILLGTKSLKLLSESTDLWADLGANAATNRGMKYLTDTGAG
SVDIEGKTCAEAWTLIDGQWEAEINAYALPFAHTMYPKLSQAAAGAKLATDVPVISQLLTGAAMPRNQFL
KQKSVVDAFEAAQLDFGNADSDSFALQRADAQTRNAMTTTAEQGLIWIPVLNVVLTVVFYALFPIVFPLL
LFPKSGIATLKGYFAGFFYLAAWGPIYVLIHMFIMDRLTAQTNAAAPGGIALANWAGIDAVNQDIATMAG
FLMMSVPVLALMVMRGTMSVASNMGSMLSAPQGAADAAALERTTGNYTFGDVSHGNFNANNRQMAQWNQA
PNLAVGASHMGLRSDDGAMTHAYGSGARVIDTSGAISQLPFKASMTRGYASDLRNQGQWYLNEADRIENG
TSASWSSTRGTFGSAVSASSQVTGSRSERGSRASDTHNVGGNVVVEGSAGKSTREVTNDDLILRQGNSRS
SGNFSTRTFGTSASLTGTGTIGTPLEGAIGSGVSASASAAISGRKETGDSASVNTERSATNQVTRGTDKS
EDVSSRVVVSGNSGDVQSSGTFSQSSDYTDASQSRTSSEGSDWRVSEAEERRAAAARYREIGSRMMNEAS
YAESHGFQVSSDMSNLIQDRYEALQREHPEWHLPDIANPRLDYRDMARRDQAISYIMDDLMSDLRNRRID
ELGDVAAIAGQGKLGSHADLGMPQAASLSPADRTPPLVASSLEGGPLLAAPEGPVDGARLARELGMGVKA
GARLGRMDGDLVPAMGVVADEARALGLPRPVVTSGNDSNQHASGSAHYDNRALDFRGNNISDQQGEQWAE
RVRERLGPNYAVDFERFPDNPARDHLHVARRRG
 
Nucleotide Sequence: 3042 bp     [Download]
>gi|113473678|ref|NC_008308.1|:139939-142980 Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence
ATGCTCGAGGTCTTCACAGTCGGCGGCGGCGAGTACCTCGTCAATACCTTCAACGCCATCGCTGCCTGGA
CCGGTTCGGGCGGGTTCAAGTCGGTGATCCGCGTCGTGATGGTGATGGGGTTGATCTACGCGCTCCTCGT
CACCGCCATGGACCTCGACTGGCGCGCCTGGTTTCGCTGGTTCATTCAGTCTACGCTGATCTACCTCGTG
CTCATGGTGCCGACGGTCACCGTCAAGGTCACCGACCGCGTCAATCCGGGGCTTGCCCCCGCCACGGTGG
CCAATGTGCCGATCGGGCTCGGCGTCATGGCCTCATTCACCAGCCAGGTGAGCGACTATTTTACCCGCAC
GGCCGAGACGGTCTTCGTCATGCCCGCCGCTCTCAATTACTCGAATGGCGGCTTCGTCTACGGCGCGCGG
ATGTGGGACAAGGTGCGCGGCTTCGAGATCCGCAATCCCGTCTTCAAGGCGAACCTCGACGGTTACCTCA
AGCAATGCGCCTATTACGACATCCTCTTGGGCACAAAGAGTCTGAAGCTGCTCAGCGAATCTACCGATCT
CTGGGCCGACCTTGGGGCCAATGCCGCGACCAACCGCGGCATGAAGTACCTGACCGATACCGGCGCCGGC
TCGGTAGACATCGAGGGCAAGACCTGTGCCGAGGCCTGGACGCTGATCGACGGGCAGTGGGAAGCCGAGA
TCAATGCCTATGCGCTGCCCTTTGCCCACACCATGTACCCCAAGCTCAGCCAGGCCGCCGCCGGGGCCAA
GCTTGCCACCGACGTGCCGGTGATTTCGCAGCTGCTCACCGGCGCCGCCATGCCGCGCAACCAGTTCCTC
AAGCAGAAGAGCGTGGTCGATGCCTTCGAGGCCGCCCAGCTCGACTTCGGCAATGCCGACAGCGATTCCT
TTGCCCTCCAGCGCGCCGATGCCCAGACCCGCAACGCCATGACCACCACGGCCGAGCAGGGGTTGATCTG
GATTCCAGTGCTGAACGTCGTGCTGACGGTCGTGTTCTACGCGCTCTTCCCGATCGTCTTTCCGCTGCTG
CTGTTCCCCAAAAGCGGCATCGCGACGCTCAAGGGATACTTCGCCGGGTTCTTCTACCTCGCCGCCTGGG
GACCGATCTACGTCCTCATCCACATGTTCATCATGGACCGGCTGACCGCTCAGACCAATGCGGCGGCGCC
GGGCGGGATTGCGCTTGCCAACTGGGCGGGGATCGACGCGGTCAACCAGGACATCGCGACGATGGCCGGG
TTCCTGATGATGTCGGTGCCGGTACTTGCGCTGATGGTCATGCGCGGCACCATGTCGGTCGCCTCGAACA
TGGGCTCGATGCTCAGCGCGCCGCAAGGGGCGGCCGATGCTGCCGCGCTCGAGCGGACCACCGGCAACTA
CACATTCGGCGATGTCAGCCATGGAAACTTCAACGCCAACAACCGCCAGATGGCGCAGTGGAACCAGGCC
CCCAATCTGGCTGTGGGCGCAAGCCACATGGGCCTCAGAAGCGACGATGGCGCGATGACCCATGCCTATG
GCAGCGGCGCGCGGGTGATCGACACCAGCGGGGCGATCTCGCAGTTGCCGTTCAAGGCCTCGATGACGCG
CGGCTATGCCAGCGATTTGCGAAATCAGGGCCAGTGGTACCTCAATGAGGCCGACCGGATCGAGAACGGC
ACCTCGGCGAGTTGGAGCAGCACACGCGGAACCTTTGGAAGCGCGGTCAGCGCCAGCAGCCAGGTGACCG
GAAGCCGCAGTGAACGCGGATCGCGCGCGTCCGACACCCACAATGTCGGCGGCAATGTCGTGGTCGAAGG
CTCGGCCGGCAAGTCGACGCGGGAGGTAACCAACGACGATCTGATCCTGCGGCAGGGCAATAGCCGTTCG
AGCGGGAATTTCTCGACAAGGACCTTTGGTACGAGCGCCTCTCTGACGGGCACCGGGACAATCGGGACCC
CGCTCGAGGGCGCCATCGGAAGCGGCGTCTCCGCTTCCGCCTCCGCGGCCATATCCGGTCGCAAGGAGAC
CGGCGACAGCGCGAGCGTAAACACCGAGCGGTCAGCAACGAACCAAGTCACCCGCGGCACCGACAAGTCC
GAGGATGTCAGCAGCCGCGTCGTCGTCAGCGGCAACAGCGGCGACGTCCAGTCTTCAGGCACGTTCAGCC
AAAGCTCCGACTACACCGATGCCAGCCAGAGCCGGACCAGCAGCGAGGGCTCCGACTGGCGGGTCTCCGA
AGCCGAGGAGCGCCGCGCCGCAGCCGCGCGCTACCGCGAGATCGGCAGCCGGATGATGAACGAAGCAAGC
TATGCGGAAAGCCACGGGTTTCAGGTCTCGAGCGACATGTCGAACCTGATCCAGGATCGATACGAGGCAC
TGCAGCGCGAGCATCCCGAGTGGCACCTGCCAGACATTGCCAACCCGCGGCTCGATTACCGCGACATGGC
ACGGCGCGATCAGGCGATCAGCTACATCATGGACGACCTGATGAGCGACCTCAGGAACCGCCGGATTGAC
GAACTGGGCGACGTCGCGGCGATCGCCGGGCAGGGCAAGCTCGGCAGCCATGCCGATCTCGGCATGCCGC
AAGCCGCATCGCTTTCGCCTGCCGATCGCACGCCGCCCCTCGTGGCCTCTTCCCTCGAGGGAGGACCACT
GCTTGCCGCTCCCGAAGGCCCGGTCGATGGTGCCAGGCTGGCCAGGGAACTCGGCATGGGCGTCAAGGCC
GGCGCGCGGCTCGGCCGAATGGACGGCGACCTCGTCCCTGCGATGGGCGTGGTGGCGGACGAGGCAAGGG
CGCTCGGGTTGCCGCGCCCGGTGGTAACTTCGGGGAATGACAGCAACCAGCATGCCTCCGGCTCGGCGCA
CTACGACAATCGCGCGCTCGACTTCCGCGGCAACAACATCTCGGACCAACAGGGAGAACAGTGGGCGGAG
CGCGTACGCGAGCGCCTGGGCCCGAATTATGCCGTCGACTTCGAAAGGTTTCCAGATAACCCTGCTCGCG
ATCACCTGCACGTTGCCAGGCGGCGTGGATAG