Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ60_RS15060 Genome accession   NZ_CP151976
Coordinates   2886416..2886556 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL W8-0502     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2881416..2891556
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ60_RS15035 (NSQ60_15035) - 2881750..2882139 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NSQ60_RS15040 (NSQ60_15040) comA 2882163..2882804 (-) 642 WP_034282566.1 response regulator transcription factor Regulator
  NSQ60_RS15045 (NSQ60_15045) comP 2882885..2885176 (-) 2292 WP_046313345.1 ATP-binding protein Regulator
  NSQ60_RS15050 (NSQ60_15050) comX 2885190..2885363 (-) 174 WP_046313343.1 competence pheromone ComX -
  NSQ60_RS15055 (NSQ60_15055) - 2885341..2886264 (-) 924 WP_046313342.1 polyprenyl synthetase family protein -
  NSQ60_RS15060 (NSQ60_15060) degQ 2886416..2886556 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSQ60_RS15065 (NSQ60_15065) - 2887062..2887418 (+) 357 WP_041115816.1 hypothetical protein -
  NSQ60_RS15070 (NSQ60_15070) - 2887454..2888680 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  NSQ60_RS15075 (NSQ60_15075) - 2888818..2890290 (-) 1473 WP_046313339.1 nicotinate phosphoribosyltransferase -
  NSQ60_RS15080 (NSQ60_15080) - 2890308..2890859 (-) 552 WP_024425949.1 isochorismatase family cysteine hydrolase -
  NSQ60_RS15085 (NSQ60_15085) - 2890920..2891327 (-) 408 WP_034282575.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=982986 NSQ60_RS15060 WP_003213123.1 2886416..2886556(-) (degQ) [Bacillus sp. FSL W8-0502]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=982986 NSQ60_RS15060 WP_003213123.1 2886416..2886556(-) (degQ) [Bacillus sp. FSL W8-0502]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment