Detailed information NTG0674433

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: MUB28_RS08720
• Genome accession: NZ_CP094945
• Coordinates: 1696808..1697236 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain VHProbi R08
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1691808..1702236

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUB28_RS08680 (MUB28_08680)	-	1691946..1692389 (-)	444	WP_041829335.1	hypothetical protein	-
MUB28_RS08685 (MUB28_08685)	-	1692463..1692882 (-)	420	WP_014727721.1	CPBP family intramembrane glutamic endopeptidase	-
MUB28_RS08690 (MUB28_08690)	-	1693131..1693328 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
MUB28_RS08695 (MUB28_08695)	-	1693577..1694770 (-)	1194	WP_014608740.1	acetate kinase	-
MUB28_RS08700 (MUB28_08700)	comYH	1694826..1695782 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
MUB28_RS08705 (MUB28_08705)	comGG	1695827..1696144 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
MUB28_RS08710 (MUB28_08710)	comYF	1696122..1696559 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
MUB28_RS08715 (MUB28_08715)	comGE	1696543..1696836 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
MUB28_RS08720 (MUB28_08720)	comYD	1696808..1697236 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
MUB28_RS08725 (MUB28_08725)	comYC	1697196..1697522 (-)	327	WP_014727724.1	competence type IV pilus major pilin ComGC	Machinery gene
MUB28_RS08730 (MUB28_08730)	comYB	1697519..1698619 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
MUB28_RS08735 (MUB28_08735)	comGA/cglA/cilD	1698501..1699442 (-)	942	WP_014727726.1	competence type IV pilus ATPase ComGA	Machinery gene
MUB28_RS08740 (MUB28_08740)	-	1699523..1699885 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=674433 MUB28_RS08720 WP_011226626.1 1696808..1697236(-) (comYD) [Streptococcus thermophilus strain VHProbi R08]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=674433 MUB28_RS08720 WP_011226626.1 1696808..1697236(-) (comYD) [Streptococcus thermophilus strain VHProbi R08]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTCAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38