Detailed information NTG0552546

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: J7T78_RS09155
• Genome accession: NZ_CP072427
• Coordinates: 1773534..1773962 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24750
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1768534..1778962

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T78_RS09110 (J7T78_09055)	-	1768671..1769114 (-)	444	WP_011681680.1	hypothetical protein	-
J7T78_RS09115	-	1769188..1769613 (-)	426	WP_014608739.1	CPBP family intramembrane glutamic endopeptidase	-
J7T78_RS09120	-	1769570..1769845 (-)	276	WP_011681681.1	hypothetical protein	-
J7T78_RS09125 (J7T78_09065)	-	1769857..1770054 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
J7T78_RS09130 (J7T78_09070)	-	1770303..1771496 (-)	1194	WP_014608740.1	acetate kinase	-
J7T78_RS09135 (J7T78_09075)	comYH	1771552..1772508 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
J7T78_RS09140 (J7T78_09080)	comGG	1772553..1772870 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
J7T78_RS09145 (J7T78_09085)	comYF	1772848..1773285 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T78_RS09150 (J7T78_09090)	comGE	1773269..1773562 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7T78_RS09155 (J7T78_09095)	comYD	1773534..1773962 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T78_RS09160 (J7T78_09100)	comYC	1773922..1774248 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T78_RS09165 (J7T78_09105)	comYB	1774245..1775345 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7T78_RS09170 (J7T78_09110)	comGA/cglA/cilD	1775227..1776168 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T78_RS09175 (J7T78_09115)	-	1776249..1776611 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=552546 J7T78_RS09155 WP_011226626.1 1773534..1773962(-) (comYD) [Streptococcus thermophilus strain S24750]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=552546 J7T78_RS09155 WP_011226626.1 1773534..1773962(-) (comYD) [Streptococcus thermophilus strain S24750]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCTAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38