Detailed information
Overview
| Name | comK/comK1 | Type | Regulator |
| Locus tag | JGY88_RS09650 | Genome accession | NZ_CP066721 |
| Coordinates | 1996555..1997118 (-) | Length | 187 a.a. |
| NCBI ID | WP_017722273.1 | Uniprot ID | A0A2T4PJ80 |
| Organism | Staphylococcus xylosus strain 2.1523 | ||
| Function | promote expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1952776..1996063 | 1996555..1997118 | flank | 492 |
Gene organization within MGE regions
Location: 1952776..1997118
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JGY88_RS09325 (JGY88_09280) | - | 1952776..1952958 (-) | 183 | WP_225486467.1 | hypothetical protein | - |
| JGY88_RS09330 (JGY88_09285) | - | 1953298..1953714 (-) | 417 | WP_225486468.1 | YolD-like family protein | - |
| JGY88_RS09335 (JGY88_09290) | - | 1953801..1954553 (-) | 753 | WP_124227073.1 | adenylate/guanylate cyclase domain-containing protein | - |
| JGY88_RS09340 (JGY88_09295) | - | 1954569..1955069 (-) | 501 | WP_225486469.1 | Pycsar system effector family protein | - |
| JGY88_RS09345 (JGY88_09300) | - | 1955157..1955324 (-) | 168 | WP_255882924.1 | SH3 domain-containing protein | - |
| JGY88_RS09350 (JGY88_09305) | - | 1955599..1956312 (+) | 714 | WP_225486471.1 | hypothetical protein | - |
| JGY88_RS09355 (JGY88_09310) | - | 1956760..1959060 (-) | 2301 | WP_225486472.1 | bifunctional glycosyltransferase family 2 protein/CDP-glycerol:glycerophosphate glycerophosphotransferase | - |
| JGY88_RS09360 (JGY88_09315) | - | 1959424..1960818 (-) | 1395 | WP_225486473.1 | N-acetylmuramoyl-L-alanine amidase | - |
| JGY88_RS09365 (JGY88_09320) | - | 1960858..1961313 (-) | 456 | WP_225486474.1 | holin family protein | - |
| JGY88_RS09370 (JGY88_09325) | - | 1961349..1961504 (-) | 156 | WP_107556223.1 | XkdX family protein | - |
| JGY88_RS09375 (JGY88_09330) | - | 1961491..1961844 (-) | 354 | WP_225486475.1 | hypothetical protein | - |
| JGY88_RS09380 (JGY88_09335) | - | 1961855..1963240 (-) | 1386 | WP_225486476.1 | BppU family phage baseplate upper protein | - |
| JGY88_RS09385 (JGY88_09340) | - | 1963253..1965271 (-) | 2019 | WP_225486477.1 | hypothetical protein | - |
| JGY88_RS09390 (JGY88_09345) | - | 1965272..1965754 (-) | 483 | WP_225486478.1 | hypothetical protein | - |
| JGY88_RS09395 (JGY88_09350) | - | 1965747..1967336 (-) | 1590 | WP_225486479.1 | prophage endopeptidase tail family protein | - |
| JGY88_RS09400 (JGY88_09355) | - | 1967346..1968173 (-) | 828 | WP_225486480.1 | phage tail domain-containing protein | - |
| JGY88_RS09405 (JGY88_09360) | - | 1968175..1973247 (-) | 5073 | WP_225486481.1 | phage tail tape measure protein | - |
| JGY88_RS09410 (JGY88_09365) | gpGT | 1973264..1973407 (-) | 144 | WP_199186119.1 | phage tail assembly chaperone GT | - |
| JGY88_RS09415 (JGY88_09370) | gpG | 1973467..1973835 (-) | 369 | WP_225486482.1 | phage tail assembly chaperone G | - |
| JGY88_RS09420 (JGY88_09375) | - | 1973901..1974080 (-) | 180 | WP_107540692.1 | hypothetical protein | - |
| JGY88_RS09425 (JGY88_09380) | - | 1974100..1974738 (-) | 639 | WP_225486483.1 | major tail protein | - |
| JGY88_RS09430 (JGY88_09385) | - | 1974750..1975145 (-) | 396 | WP_225486484.1 | hypothetical protein | - |
| JGY88_RS09435 (JGY88_09390) | - | 1975166..1975555 (-) | 390 | WP_225486485.1 | hypothetical protein | - |
| JGY88_RS09440 (JGY88_09395) | - | 1975545..1975913 (-) | 369 | WP_225486486.1 | hypothetical protein | - |
| JGY88_RS09445 (JGY88_09400) | - | 1975897..1976184 (-) | 288 | WP_107599669.1 | hypothetical protein | - |
| JGY88_RS09450 (JGY88_09405) | - | 1976202..1977413 (-) | 1212 | WP_225486487.1 | phage major capsid protein | - |
| JGY88_RS09455 (JGY88_09410) | - | 1977425..1978126 (-) | 702 | WP_225486488.1 | head maturation protease, ClpP-related | - |
| JGY88_RS09460 (JGY88_09415) | - | 1978101..1979267 (-) | 1167 | WP_225486489.1 | phage portal protein | - |
| JGY88_RS09465 (JGY88_09420) | - | 1979283..1980953 (-) | 1671 | WP_225486490.1 | terminase TerL endonuclease subunit | - |
| JGY88_RS09470 (JGY88_09425) | - | 1980950..1981312 (-) | 363 | WP_225486492.1 | hypothetical protein | - |
| JGY88_RS09475 (JGY88_09430) | - | 1981490..1981804 (-) | 315 | WP_225486494.1 | HNH endonuclease | - |
| JGY88_RS09480 (JGY88_09435) | - | 1982091..1982489 (-) | 399 | WP_107540680.1 | hypothetical protein | - |
| JGY88_RS14440 (JGY88_09440) | - | 1982503..1982649 (-) | 147 | WP_158256560.1 | DUF1514 family protein | - |
| JGY88_RS09490 (JGY88_09445) | - | 1982649..1982945 (-) | 297 | WP_225486495.1 | DUF5052 family protein | - |
| JGY88_RS09495 (JGY88_09450) | rinB | 1982949..1983107 (-) | 159 | WP_225486497.1 | transcriptional activator RinB | - |
| JGY88_RS09500 (JGY88_09455) | - | 1983111..1983341 (-) | 231 | WP_225486498.1 | hypothetical protein | - |
| JGY88_RS09505 (JGY88_09460) | - | 1983680..1983940 (+) | 261 | WP_225486499.1 | YrhK family protein | - |
| JGY88_RS09510 (JGY88_09465) | - | 1983985..1984284 (-) | 300 | WP_107606929.1 | MazG-like family protein | - |
| JGY88_RS09515 (JGY88_09470) | - | 1984344..1984658 (+) | 315 | WP_225486500.1 | hypothetical protein | - |
| JGY88_RS09520 (JGY88_09475) | - | 1984642..1984908 (-) | 267 | WP_065865344.1 | MW1434 family type I TA system toxin | - |
| JGY88_RS09525 (JGY88_09480) | - | 1984909..1985229 (-) | 321 | WP_225486501.1 | hypothetical protein | - |
| JGY88_RS09530 (JGY88_09485) | - | 1985361..1985621 (-) | 261 | WP_225486502.1 | YopX family protein | - |
| JGY88_RS09535 (JGY88_09490) | - | 1985703..1985846 (-) | 144 | WP_225486503.1 | hypothetical protein | - |
| JGY88_RS09540 (JGY88_09495) | - | 1986192..1986593 (-) | 402 | WP_225486504.1 | hypothetical protein | - |
| JGY88_RS09545 (JGY88_09500) | - | 1986607..1986813 (-) | 207 | WP_225486506.1 | hypothetical protein | - |
| JGY88_RS09550 (JGY88_09505) | - | 1986819..1987220 (-) | 402 | WP_225486507.1 | DUF1064 domain-containing protein | - |
| JGY88_RS09555 (JGY88_09510) | - | 1987232..1987444 (-) | 213 | WP_225486508.1 | hypothetical protein | - |
| JGY88_RS09560 (JGY88_09515) | - | 1987445..1987615 (-) | 171 | WP_225486509.1 | hypothetical protein | - |
| JGY88_RS09565 (JGY88_09520) | - | 1987616..1988398 (-) | 783 | WP_225486510.1 | ATP-binding protein | - |
| JGY88_RS09570 (JGY88_09525) | - | 1988411..1989166 (-) | 756 | WP_225486511.1 | DnaD domain protein | - |
| JGY88_RS09575 (JGY88_09530) | - | 1989153..1989830 (-) | 678 | WP_225486512.1 | putative HNHc nuclease | - |
| JGY88_RS09580 (JGY88_09535) | ssbA | 1989842..1990291 (-) | 450 | WP_225486513.1 | single-stranded DNA-binding protein | Machinery gene |
| JGY88_RS09585 (JGY88_09540) | - | 1990291..1990911 (-) | 621 | WP_225486515.1 | DUF1071 domain-containing protein | - |
| JGY88_RS09590 (JGY88_09545) | - | 1990904..1991164 (-) | 261 | WP_225486516.1 | hypothetical protein | - |
| JGY88_RS09595 (JGY88_09550) | - | 1991228..1991407 (-) | 180 | WP_225486517.1 | hypothetical protein | - |
| JGY88_RS09600 (JGY88_09555) | - | 1991420..1991704 (-) | 285 | WP_225486518.1 | DUF771 domain-containing protein | - |
| JGY88_RS09605 (JGY88_09560) | - | 1991716..1992456 (-) | 741 | WP_225486519.1 | phage antirepressor KilAC domain-containing protein | - |
| JGY88_RS09610 (JGY88_09565) | - | 1992611..1992841 (-) | 231 | WP_225486520.1 | helix-turn-helix transcriptional regulator | - |
| JGY88_RS09615 (JGY88_09570) | - | 1993007..1993339 (+) | 333 | WP_225486521.1 | helix-turn-helix transcriptional regulator | - |
| JGY88_RS09620 (JGY88_09575) | - | 1993351..1993815 (+) | 465 | WP_225486523.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JGY88_RS09625 (JGY88_09580) | - | 1993902..1994453 (+) | 552 | WP_225486524.1 | Ltp family lipoprotein | - |
| JGY88_RS09630 (JGY88_09585) | - | 1994517..1994975 (+) | 459 | WP_225486525.1 | hypothetical protein | - |
| JGY88_RS09635 (JGY88_09590) | - | 1995032..1996063 (+) | 1032 | WP_225486526.1 | site-specific integrase | - |
| JGY88_RS09650 (JGY88_09605) | comK/comK1 | 1996555..1997118 (-) | 564 | WP_017722273.1 | competence protein ComK | Regulator |
Sequence
Protein
Download Length: 187 a.a. Molecular weight: 21879.23 Da Isoelectric Point: 9.5361
>NTDB_id=522149 JGY88_RS09650 WP_017722273.1 1996555..1997118(-) (comK/comK1) [Staphylococcus xylosus strain 2.1523]
MIQPYIIKKGDMVLQPCNLATGQYEGSYLLRYKADSQIIKERVSKIIDRSCRFYGSSYVFKKEDTMRITGISSKPPILFT
PLFPTYFFPTHSDRKADNTWINIHYVHNIRPLKEKKCKVTFVDNQSIVANISAHSMHHQYLNGIYYYYMMDRAARVATFD
PDSPIDYTKPQLNIYEALAKYSLFESK
MIQPYIIKKGDMVLQPCNLATGQYEGSYLLRYKADSQIIKERVSKIIDRSCRFYGSSYVFKKEDTMRITGISSKPPILFT
PLFPTYFFPTHSDRKADNTWINIHYVHNIRPLKEKKCKVTFVDNQSIVANISAHSMHHQYLNGIYYYYMMDRAARVATFD
PDSPIDYTKPQLNIYEALAKYSLFESK
Nucleotide
Download Length: 564 bp
>NTDB_id=522149 JGY88_RS09650 WP_017722273.1 1996555..1997118(-) (comK/comK1) [Staphylococcus xylosus strain 2.1523]
ATGATTCAACCGTATATTATTAAAAAAGGTGATATGGTTTTACAACCATGTAATTTAGCTACTGGACAATATGAAGGTAG
TTACTTGCTAAGGTATAAAGCTGACAGTCAAATTATTAAAGAACGAGTATCTAAAATCATCGACCGTTCATGTAGGTTTT
ATGGTAGCAGTTATGTATTTAAAAAAGAAGATACCATGCGTATTACAGGCATAAGCAGTAAGCCACCTATTCTATTCACT
CCATTATTTCCCACTTATTTCTTTCCCACACACTCTGATCGTAAAGCAGATAATACCTGGATTAATATCCATTATGTACA
TAATATTAGACCACTTAAAGAAAAGAAATGTAAGGTTACCTTTGTAGATAATCAAAGTATTGTAGCTAACATTTCTGCTC
ATAGTATGCATCATCAATATTTAAATGGTATATATTATTATTACATGATGGATAGGGCAGCTAGAGTCGCTACATTTGAT
CCTGATTCACCGATTGATTATACTAAGCCACAATTAAATATATATGAAGCATTGGCAAAATATTCGTTATTTGAATCGAA
ATAG
ATGATTCAACCGTATATTATTAAAAAAGGTGATATGGTTTTACAACCATGTAATTTAGCTACTGGACAATATGAAGGTAG
TTACTTGCTAAGGTATAAAGCTGACAGTCAAATTATTAAAGAACGAGTATCTAAAATCATCGACCGTTCATGTAGGTTTT
ATGGTAGCAGTTATGTATTTAAAAAAGAAGATACCATGCGTATTACAGGCATAAGCAGTAAGCCACCTATTCTATTCACT
CCATTATTTCCCACTTATTTCTTTCCCACACACTCTGATCGTAAAGCAGATAATACCTGGATTAATATCCATTATGTACA
TAATATTAGACCACTTAAAGAAAAGAAATGTAAGGTTACCTTTGTAGATAATCAAAGTATTGTAGCTAACATTTCTGCTC
ATAGTATGCATCATCAATATTTAAATGGTATATATTATTATTACATGATGGATAGGGCAGCTAGAGTCGCTACATTTGAT
CCTGATTCACCGATTGATTATACTAAGCCACAATTAAATATATATGAAGCATTGGCAAAATATTCGTTATTTGAATCGAA
ATAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comK/comK1 | Staphylococcus aureus MW2 |
55.738 |
97.861 |
0.545 |
| comK/comK1 | Staphylococcus aureus N315 |
55.738 |
97.861 |
0.545 |