Detailed information    

insolico Bioinformatically predicted

Overview


Name   comK/comK1   Type   Regulator
Locus tag   JGY88_RS09650 Genome accession   NZ_CP066721
Coordinates   1996555..1997118 (-) Length   187 a.a.
NCBI ID   WP_017722273.1    Uniprot ID   A0A2T4PJ80
Organism   Staphylococcus xylosus strain 2.1523     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1952776..1996063 1996555..1997118 flank 492


Gene organization within MGE regions


Location: 1952776..1997118
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JGY88_RS09325 (JGY88_09280) - 1952776..1952958 (-) 183 WP_225486467.1 hypothetical protein -
  JGY88_RS09330 (JGY88_09285) - 1953298..1953714 (-) 417 WP_225486468.1 YolD-like family protein -
  JGY88_RS09335 (JGY88_09290) - 1953801..1954553 (-) 753 WP_124227073.1 adenylate/guanylate cyclase domain-containing protein -
  JGY88_RS09340 (JGY88_09295) - 1954569..1955069 (-) 501 WP_225486469.1 Pycsar system effector family protein -
  JGY88_RS09345 (JGY88_09300) - 1955157..1955324 (-) 168 WP_255882924.1 SH3 domain-containing protein -
  JGY88_RS09350 (JGY88_09305) - 1955599..1956312 (+) 714 WP_225486471.1 hypothetical protein -
  JGY88_RS09355 (JGY88_09310) - 1956760..1959060 (-) 2301 WP_225486472.1 bifunctional glycosyltransferase family 2 protein/CDP-glycerol:glycerophosphate glycerophosphotransferase -
  JGY88_RS09360 (JGY88_09315) - 1959424..1960818 (-) 1395 WP_225486473.1 N-acetylmuramoyl-L-alanine amidase -
  JGY88_RS09365 (JGY88_09320) - 1960858..1961313 (-) 456 WP_225486474.1 holin family protein -
  JGY88_RS09370 (JGY88_09325) - 1961349..1961504 (-) 156 WP_107556223.1 XkdX family protein -
  JGY88_RS09375 (JGY88_09330) - 1961491..1961844 (-) 354 WP_225486475.1 hypothetical protein -
  JGY88_RS09380 (JGY88_09335) - 1961855..1963240 (-) 1386 WP_225486476.1 BppU family phage baseplate upper protein -
  JGY88_RS09385 (JGY88_09340) - 1963253..1965271 (-) 2019 WP_225486477.1 hypothetical protein -
  JGY88_RS09390 (JGY88_09345) - 1965272..1965754 (-) 483 WP_225486478.1 hypothetical protein -
  JGY88_RS09395 (JGY88_09350) - 1965747..1967336 (-) 1590 WP_225486479.1 prophage endopeptidase tail family protein -
  JGY88_RS09400 (JGY88_09355) - 1967346..1968173 (-) 828 WP_225486480.1 phage tail domain-containing protein -
  JGY88_RS09405 (JGY88_09360) - 1968175..1973247 (-) 5073 WP_225486481.1 phage tail tape measure protein -
  JGY88_RS09410 (JGY88_09365) gpGT 1973264..1973407 (-) 144 WP_199186119.1 phage tail assembly chaperone GT -
  JGY88_RS09415 (JGY88_09370) gpG 1973467..1973835 (-) 369 WP_225486482.1 phage tail assembly chaperone G -
  JGY88_RS09420 (JGY88_09375) - 1973901..1974080 (-) 180 WP_107540692.1 hypothetical protein -
  JGY88_RS09425 (JGY88_09380) - 1974100..1974738 (-) 639 WP_225486483.1 major tail protein -
  JGY88_RS09430 (JGY88_09385) - 1974750..1975145 (-) 396 WP_225486484.1 hypothetical protein -
  JGY88_RS09435 (JGY88_09390) - 1975166..1975555 (-) 390 WP_225486485.1 hypothetical protein -
  JGY88_RS09440 (JGY88_09395) - 1975545..1975913 (-) 369 WP_225486486.1 hypothetical protein -
  JGY88_RS09445 (JGY88_09400) - 1975897..1976184 (-) 288 WP_107599669.1 hypothetical protein -
  JGY88_RS09450 (JGY88_09405) - 1976202..1977413 (-) 1212 WP_225486487.1 phage major capsid protein -
  JGY88_RS09455 (JGY88_09410) - 1977425..1978126 (-) 702 WP_225486488.1 head maturation protease, ClpP-related -
  JGY88_RS09460 (JGY88_09415) - 1978101..1979267 (-) 1167 WP_225486489.1 phage portal protein -
  JGY88_RS09465 (JGY88_09420) - 1979283..1980953 (-) 1671 WP_225486490.1 terminase TerL endonuclease subunit -
  JGY88_RS09470 (JGY88_09425) - 1980950..1981312 (-) 363 WP_225486492.1 hypothetical protein -
  JGY88_RS09475 (JGY88_09430) - 1981490..1981804 (-) 315 WP_225486494.1 HNH endonuclease -
  JGY88_RS09480 (JGY88_09435) - 1982091..1982489 (-) 399 WP_107540680.1 hypothetical protein -
  JGY88_RS14440 (JGY88_09440) - 1982503..1982649 (-) 147 WP_158256560.1 DUF1514 family protein -
  JGY88_RS09490 (JGY88_09445) - 1982649..1982945 (-) 297 WP_225486495.1 DUF5052 family protein -
  JGY88_RS09495 (JGY88_09450) rinB 1982949..1983107 (-) 159 WP_225486497.1 transcriptional activator RinB -
  JGY88_RS09500 (JGY88_09455) - 1983111..1983341 (-) 231 WP_225486498.1 hypothetical protein -
  JGY88_RS09505 (JGY88_09460) - 1983680..1983940 (+) 261 WP_225486499.1 YrhK family protein -
  JGY88_RS09510 (JGY88_09465) - 1983985..1984284 (-) 300 WP_107606929.1 MazG-like family protein -
  JGY88_RS09515 (JGY88_09470) - 1984344..1984658 (+) 315 WP_225486500.1 hypothetical protein -
  JGY88_RS09520 (JGY88_09475) - 1984642..1984908 (-) 267 WP_065865344.1 MW1434 family type I TA system toxin -
  JGY88_RS09525 (JGY88_09480) - 1984909..1985229 (-) 321 WP_225486501.1 hypothetical protein -
  JGY88_RS09530 (JGY88_09485) - 1985361..1985621 (-) 261 WP_225486502.1 YopX family protein -
  JGY88_RS09535 (JGY88_09490) - 1985703..1985846 (-) 144 WP_225486503.1 hypothetical protein -
  JGY88_RS09540 (JGY88_09495) - 1986192..1986593 (-) 402 WP_225486504.1 hypothetical protein -
  JGY88_RS09545 (JGY88_09500) - 1986607..1986813 (-) 207 WP_225486506.1 hypothetical protein -
  JGY88_RS09550 (JGY88_09505) - 1986819..1987220 (-) 402 WP_225486507.1 DUF1064 domain-containing protein -
  JGY88_RS09555 (JGY88_09510) - 1987232..1987444 (-) 213 WP_225486508.1 hypothetical protein -
  JGY88_RS09560 (JGY88_09515) - 1987445..1987615 (-) 171 WP_225486509.1 hypothetical protein -
  JGY88_RS09565 (JGY88_09520) - 1987616..1988398 (-) 783 WP_225486510.1 ATP-binding protein -
  JGY88_RS09570 (JGY88_09525) - 1988411..1989166 (-) 756 WP_225486511.1 DnaD domain protein -
  JGY88_RS09575 (JGY88_09530) - 1989153..1989830 (-) 678 WP_225486512.1 putative HNHc nuclease -
  JGY88_RS09580 (JGY88_09535) ssbA 1989842..1990291 (-) 450 WP_225486513.1 single-stranded DNA-binding protein Machinery gene
  JGY88_RS09585 (JGY88_09540) - 1990291..1990911 (-) 621 WP_225486515.1 DUF1071 domain-containing protein -
  JGY88_RS09590 (JGY88_09545) - 1990904..1991164 (-) 261 WP_225486516.1 hypothetical protein -
  JGY88_RS09595 (JGY88_09550) - 1991228..1991407 (-) 180 WP_225486517.1 hypothetical protein -
  JGY88_RS09600 (JGY88_09555) - 1991420..1991704 (-) 285 WP_225486518.1 DUF771 domain-containing protein -
  JGY88_RS09605 (JGY88_09560) - 1991716..1992456 (-) 741 WP_225486519.1 phage antirepressor KilAC domain-containing protein -
  JGY88_RS09610 (JGY88_09565) - 1992611..1992841 (-) 231 WP_225486520.1 helix-turn-helix transcriptional regulator -
  JGY88_RS09615 (JGY88_09570) - 1993007..1993339 (+) 333 WP_225486521.1 helix-turn-helix transcriptional regulator -
  JGY88_RS09620 (JGY88_09575) - 1993351..1993815 (+) 465 WP_225486523.1 ImmA/IrrE family metallo-endopeptidase -
  JGY88_RS09625 (JGY88_09580) - 1993902..1994453 (+) 552 WP_225486524.1 Ltp family lipoprotein -
  JGY88_RS09630 (JGY88_09585) - 1994517..1994975 (+) 459 WP_225486525.1 hypothetical protein -
  JGY88_RS09635 (JGY88_09590) - 1995032..1996063 (+) 1032 WP_225486526.1 site-specific integrase -
  JGY88_RS09650 (JGY88_09605) comK/comK1 1996555..1997118 (-) 564 WP_017722273.1 competence protein ComK Regulator

Sequence


Protein


Download         Length: 187 a.a.        Molecular weight: 21879.23 Da        Isoelectric Point: 9.5361

>NTDB_id=522149 JGY88_RS09650 WP_017722273.1 1996555..1997118(-) (comK/comK1) [Staphylococcus xylosus strain 2.1523]
MIQPYIIKKGDMVLQPCNLATGQYEGSYLLRYKADSQIIKERVSKIIDRSCRFYGSSYVFKKEDTMRITGISSKPPILFT
PLFPTYFFPTHSDRKADNTWINIHYVHNIRPLKEKKCKVTFVDNQSIVANISAHSMHHQYLNGIYYYYMMDRAARVATFD
PDSPIDYTKPQLNIYEALAKYSLFESK

Nucleotide


Download         Length: 564 bp        

>NTDB_id=522149 JGY88_RS09650 WP_017722273.1 1996555..1997118(-) (comK/comK1) [Staphylococcus xylosus strain 2.1523]
ATGATTCAACCGTATATTATTAAAAAAGGTGATATGGTTTTACAACCATGTAATTTAGCTACTGGACAATATGAAGGTAG
TTACTTGCTAAGGTATAAAGCTGACAGTCAAATTATTAAAGAACGAGTATCTAAAATCATCGACCGTTCATGTAGGTTTT
ATGGTAGCAGTTATGTATTTAAAAAAGAAGATACCATGCGTATTACAGGCATAAGCAGTAAGCCACCTATTCTATTCACT
CCATTATTTCCCACTTATTTCTTTCCCACACACTCTGATCGTAAAGCAGATAATACCTGGATTAATATCCATTATGTACA
TAATATTAGACCACTTAAAGAAAAGAAATGTAAGGTTACCTTTGTAGATAATCAAAGTATTGTAGCTAACATTTCTGCTC
ATAGTATGCATCATCAATATTTAAATGGTATATATTATTATTACATGATGGATAGGGCAGCTAGAGTCGCTACATTTGAT
CCTGATTCACCGATTGATTATACTAAGCCACAATTAAATATATATGAAGCATTGGCAAAATATTCGTTATTTGAATCGAA
ATAG

Domains


Predicted by InterproScan.

(4-152)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2T4PJ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

55.738

97.861

0.545

  comK/comK1 Staphylococcus aureus N315

55.738

97.861

0.545