Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   I6G23_RS03480 Genome accession   NZ_CP065735
Coordinates   421269..421544 (+) Length   91 a.a.
NCBI ID   WP_257012268.1    Uniprot ID   -
Organism   Lactococcus lactis strain FDAARGOS_866     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 416269..426544
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6G23_RS03450 (I6G23_03450) comGA 417851..418789 (+) 939 WP_010906320.1 competence type IV pilus ATPase ComGA Machinery gene
  I6G23_RS03455 (I6G23_03455) comGB 418683..419756 (+) 1074 WP_010906319.1 competence type IV pilus assembly protein ComGB Machinery gene
  I6G23_RS03460 (I6G23_03460) comGC 419884..420153 (+) 270 WP_023349160.1 competence type IV pilus major pilin ComGC Machinery gene
  I6G23_RS03465 (I6G23_03465) comGD 420128..420544 (+) 417 WP_021216554.1 competence type IV pilus minor pilin ComGD Machinery gene
  I6G23_RS03470 (I6G23_03470) comGE 420516..420812 (+) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  I6G23_RS03475 (I6G23_03475) comGF 420775..421221 (+) 447 WP_031296844.1 competence type IV pilus minor pilin ComGF Machinery gene
  I6G23_RS03480 (I6G23_03480) comGG 421269..421544 (+) 276 WP_257012268.1 hypothetical protein Machinery gene
  I6G23_RS03485 (I6G23_03485) - 421625..422062 (+) 438 WP_010906313.1 zinc-dependent MarR family transcriptional regulator -
  I6G23_RS03490 (I6G23_03490) - 422059..422901 (+) 843 WP_010906312.1 metal ABC transporter substrate-binding protein -
  I6G23_RS03495 (I6G23_03495) - 423078..423815 (+) 738 WP_010906311.1 metal ABC transporter ATP-binding protein -
  I6G23_RS03500 (I6G23_03500) - 423808..424617 (+) 810 WP_010906310.1 metal ABC transporter permease -
  I6G23_RS03505 (I6G23_03505) - 424656..425522 (-) 867 WP_010906309.1 RluA family pseudouridine synthase -
  I6G23_RS03510 (I6G23_03510) - 425728..426105 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence

Protein


Download         Length: 91 a.a.        Molecular weight: 10417.58 Da        Isoelectric Point: 5.0604

>NTDB_id=513666 I6G23_RS03480 WP_257012268.1 421269..421544(+) (comGG) [Lactococcus lactis strain FDAARGOS_866]
MFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQFSIH
LKDGANFQIKN

Nucleotide


Download         Length: 276 bp        

>NTDB_id=513666 I6G23_RS03480 WP_257012268.1 421269..421544(+) (comGG) [Lactococcus lactis strain FDAARGOS_866]
ATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTTAACAGCTGA
ATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATTTGTCCTACA
ATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTTAGTATCCAT
CTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.889

98.901

0.582