Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HMPREF0462_RS06690 Genome accession   NC_017375
Coordinates   1365573..1365698 (-) Length   41 a.a.
NCBI ID   WP_000688336.1    Uniprot ID   -
Organism   Helicobacter pylori 83     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1360573..1370698
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HMPREF0462_RS06670 (HMPREF0462_1361) - 1361253..1362665 (-) 1413 WP_000694851.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HMPREF0462_RS06675 (HMPREF0462_1362) comB10 1362736..1363872 (-) 1137 WP_001045738.1 DNA type IV secretion system protein ComB10 Machinery gene
  HMPREF0462_RS06680 (HMPREF0462_1363) comB9 1363865..1364833 (-) 969 WP_014536593.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HMPREF0462_RS06685 (HMPREF0462_1364) comB8 1364833..1365576 (-) 744 WP_000660541.1 type IV secretion system protein Machinery gene
  HMPREF0462_RS06690 comB7 1365573..1365698 (-) 126 WP_000688336.1 hypothetical protein Machinery gene
  HMPREF0462_RS06695 (HMPREF0462_1365) comB6 1365714..1366769 (-) 1056 WP_000786668.1 P-type conjugative transfer protein TrbL Machinery gene
  HMPREF0462_RS06700 (HMPREF0462_1366) - 1366777..1367772 (-) 996 WP_000468430.1 PDZ domain-containing protein -
  HMPREF0462_RS06705 (HMPREF0462_1367) - 1367772..1368065 (-) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  HMPREF0462_RS06710 (HMPREF0462_1368) panD 1368076..1368426 (-) 351 WP_000142274.1 aspartate 1-decarboxylase -
  HMPREF0462_RS06715 (HMPREF0462_1369) - 1368416..1370638 (-) 2223 WP_001051537.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4770.81 Da        Isoelectric Point: 9.3013

>NTDB_id=47011 HMPREF0462_RS06690 WP_000688336.1 1365573..1365698(-) (comB7) [Helicobacter pylori 83]
MKIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=47011 HMPREF0462_RS06690 WP_000688336.1 1365573..1365698(-) (comB7) [Helicobacter pylori 83]
ATGAAAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment