Detailed information NTG0242987

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: CGP95_RS07865
• Genome accession: NZ_CP022899
• Coordinates: 1600558..1600869 (-)
• Length: 103 a.a.
• NCBI ID: WP_115283859.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 143
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1595558..1605869

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CGP95_RS07830 (CGP95_01444)	gcvPA	1596060..1597406 (-)	1347	WP_000019697.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
CGP95_RS07835 (CGP95_01445)	gcvT	1597426..1598517 (-)	1092	WP_000093347.1	glycine cleavage system aminomethyltransferase GcvT	-
CGP95_RS07840 (CGP95_01446)	-	1598676..1599200 (-)	525	WP_001015125.1	shikimate kinase	-
CGP95_RS07845	-	1599190..1599336 (-)	147	WP_001789879.1	hypothetical protein	-
CGP95_RS07850 (CGP95_01447)	comGF	1599433..1599930 (-)	498	WP_001794055.1	competence type IV pilus minor pilin ComGF	Machinery gene
CGP95_RS07855 (CGP95_01448)	comGE	1599848..1600147 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
CGP95_RS07860 (CGP95_01449)	comGD	1600134..1600580 (-)	447	WP_001791207.1	competence type IV pilus minor pilin ComGD	Machinery gene
CGP95_RS07865 (CGP95_01450)	comGC	1600558..1600869 (-)	312	WP_115283859.1	competence type IV pilus major pilin ComGC	Machinery gene
CGP95_RS07870 (CGP95_01451)	comGB	1600883..1601953 (-)	1071	WP_000776412.1	competence type IV pilus assembly protein ComGB	Machinery gene
CGP95_RS07875 (CGP95_01452)	comGA	1601925..1602899 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
CGP95_RS07880 (CGP95_01453)	-	1602951..1603574 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
CGP95_RS07885 (CGP95_01454)	-	1603571..1603900 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
CGP95_RS07890 (CGP95_01455)	-	1603900..1604886 (-)	987	WP_000161314.1	ROK family glucokinase	-
CGP95_RS07895	-	1604883..1605086 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11392.44 Da
• Isoelectric Point: 8.5207

>NTDB_id=242987 CGP95_RS07865 WP_115283859.1 1600558..1600869(-) (comGC) [Staphylococcus aureus strain 143]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTARIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=242987 CGP95_RS07865 WP_115283859.1 1600558..1600869(-) (comGC) [Staphylococcus aureus strain 143]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCGCATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	98.058	100	0.981
comGC	Staphylococcus aureus MW2	98.058	100	0.981
comGC/cglC	Streptococcus mitis SK321	48.039	99.029	0.476
comGC/cglC	Streptococcus pneumoniae R6	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae D39	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae TIGR4	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae Rx1	47.059	99.029	0.466
comGC/cglC	Streptococcus mitis NCTC 12261	52.326	83.495	0.437
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comYC	Streptococcus mutans UA140	50	73.786	0.369
comYC	Streptococcus mutans UA159	50	73.786	0.369
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369