Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 117..143954 | Replicon | plasmid pKPC-f607 |
| Accession | NZ_CP026272 | ||
| Organism | Klebsiella oxytoca strain KONIH4 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | C2U44_RS31690 | Protein ID | WP_013023785.1 |
| Coordinates | 119..424 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | C2U44_RS31685 | Protein ID | WP_001568025.1 |
| Coordinates | 143954..117 (+) | Length | -47945.333333333 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C2U44_RS31690 | 119..424 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| C2U44_RS31695 | 593..988 | + | 396 | WP_017899885.1 | hypothetical protein | - |
| C2U44_RS31700 | 1015..1329 | + | 315 | WP_053389906.1 | hypothetical protein | - |
| C2U44_RS31705 | 1340..2356 | + | 1017 | WP_017899884.1 | hypothetical protein | - |
| C2U44_RS31710 | 2554..3348 | + | 795 | WP_004197635.1 | site-specific integrase | - |
| C2U44_RS35610 | 3844..4146 | - | 303 | WP_071571079.1 | hypothetical protein | - |
| C2U44_RS31720 | 4143..4769 | - | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
| C2U44_RS31725 | 5402..6277 | - | 876 | WP_004098982.1 | RepB family plasmid replication initiator protein | - |
| C2U44_RS31730 | 6689..7849 | - | 1161 | Protein_9 | translesion error-prone DNA polymerase V subunit UmuC | - |
| C2U44_RS35615 | 7800..7901 | + | 102 | Protein_10 | TetR family transcriptional regulator | - |
| C2U44_RS31735 | 7913..8617 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| C2U44_RS31745 | 8669..10435 | + | 1767 | Protein_12 | Tn3 family transposase | - |
| C2U44_RS31750 | 10514..11518 | + | 1005 | WP_000427619.1 | IS110-like element IS5075 family transposase | - |
| C2U44_RS31755 | 11700..11876 | - | 177 | WP_000954592.1 | Arm DNA-binding domain-containing protein | - |
| C2U44_RS31765 | 12206..13021 | + | 816 | WP_001043260.1 | sulfonamide-resistant dihydropteroate synthase Sul2 | - |
| C2U44_RS31770 | 13082..13885 | + | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| C2U44_RS31775 | 13885..14721 | + | 837 | WP_000480968.1 | aminoglycoside O-phosphotransferase APH(6)-Id | - |
| C2U44_RS31780 | 14879..15364 | + | 486 | Protein_18 | IS110 family transposase | - |
| C2U44_RS31785 | 15648..16652 | - | 1005 | WP_000427623.1 | IS110-like element IS4321 family transposase | - |
| C2U44_RS31790 | 16731..19703 | - | 2973 | WP_001138073.1 | Tn3 family transposase | - |
| C2U44_RS31795 | 19706..20263 | - | 558 | WP_001162012.1 | recombinase family protein | - |
| C2U44_RS31805 | 20393..20605 | - | 213 | WP_000993245.1 | DUF3330 domain-containing protein | - |
| C2U44_RS31815 | 20671..20907 | - | 237 | WP_001087807.1 | broad-spectrum mercury transporter MerE | - |
| C2U44_RS31820 | 20904..21269 | - | 366 | WP_001277463.1 | mercury resistance co-regulator MerD | - |
| C2U44_RS31825 | 21287..22969 | - | 1683 | WP_000281123.1 | mercury(II) reductase | - |
| C2U44_RS31830 | 23008..23415 | - | 408 | WP_000522993.1 | organomercurial transporter MerC | - |
| C2U44_RS31835 | 23443..23718 | - | 276 | WP_000732276.1 | mercury resistance system periplasmic binding protein MerP | - |
| C2U44_RS31840 | 23734..24084 | - | 351 | WP_001294660.1 | mercuric transport protein MerT | - |
| C2U44_RS31845 | 24156..24611 | + | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
| C2U44_RS31850 | 24632..25180 | + | 549 | Protein_30 | IS110 family transposase | - |
| C2U44_RS31855 | 25470..25874 | - | 405 | Protein_31 | IS91 family transposase | - |
| C2U44_RS31860 | 26084..26944 | - | 861 | WP_000027057.1 | class A broad-spectrum beta-lactamase TEM-1 | - |
| C2U44_RS31865 | 27127..27444 | - | 318 | Protein_33 | recombinase family protein | - |
| C2U44_RS31870 | 27644..28468 | - | 825 | WP_000722315.1 | oxacillin-hydrolyzing class D beta-lactamase OXA-9 | - |
| C2U44_RS31875 | 28528..29316 | - | 789 | WP_001206315.1 | ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 | - |
| C2U44_RS31880 | 29386..29940 | - | 555 | WP_014454105.1 | aminoglycoside N-acetyltransferase AAC(6')-Ib' | - |
| C2U44_RS31885 | 30174..30731 | - | 558 | WP_001217881.1 | recombinase family protein | - |
| C2U44_RS31890 | 30895..31794 | + | 900 | Protein_38 | DUF4158 domain-containing protein | - |
| C2U44_RS31895 | 31846..33561 | - | 1716 | WP_004152391.1 | Tn3-like element Tn4401 family resolvase TnpR | - |
| C2U44_RS31900 | 33671..36700 | + | 3030 | WP_004152392.1 | Tn3-like element Tn4401 family transposase | - |
| C2U44_RS31905 | 36807..37832 | + | 1026 | WP_004199214.1 | IS21 family transposase | - |
| C2U44_RS31910 | 37829..38608 | + | 780 | WP_004152394.1 | IS21-like element ISKpn7 family helper ATPase IstB | - |
| C2U44_RS31920 | 38995..39876 | + | 882 | WP_004199234.1 | carbapenem-hydrolyzing class A beta-lactamase KPC-2 | - |
| C2U44_RS31925 | 40126..41445 | - | 1320 | WP_004152397.1 | IS1182-like element ISKpn6 family transposase | - |
| C2U44_RS31935 | 41798..42916 | + | 1119 | Protein_45 | transposase | - |
| C2U44_RS31940 | 42921..43466 | - | 546 | WP_103433629.1 | response regulator | - |
| C2U44_RS31945 | 43463..44590 | - | 1128 | WP_004118230.1 | transporter substrate-binding protein | - |
| C2U44_RS31950 | 44875..45042 | - | 168 | WP_004118231.1 | integrase | - |
| C2U44_RS31960 | 46044..47039 | + | 996 | WP_020326536.1 | IS110 family transposase | - |
| C2U44_RS31965 | 47175..47810 | - | 636 | WP_023317852.1 | hypothetical protein | - |
| C2U44_RS31980 | 49049..49855 | - | 807 | WP_099973685.1 | incFII family plasmid replication initiator RepA | - |
| C2U44_RS31985 | 49914..49985 | - | 72 | WP_009653899.1 | RepA leader peptide Tap | - |
| C2U44_RS31995 | 50203..50472 | - | 270 | WP_032736837.1 | replication regulatory protein RepA | - |
| C2U44_RS32000 | 50610..51152 | - | 543 | WP_032736899.1 | phospholipase D family protein | - |
| C2U44_RS32005 | 51342..51596 | - | 255 | Protein_55 | hypothetical protein | - |
| C2U44_RS32010 | 51636..52427 | - | 792 | WP_009653900.1 | DsbA family protein | - |
| C2U44_RS32015 | 52540..53133 | - | 594 | WP_009653903.1 | fertility inhibition protein FinO | - |
| C2U44_RS32020 | 53294..54013 | - | 720 | WP_032736839.1 | type-F conjugative transfer system pilin acetylase TraX | - |
| C2U44_RS32025 | 54097..59355 | - | 5259 | WP_042946280.1 | conjugative transfer relaxase/helicase TraI | - |
| C2U44_RS32030 | 59355..61649 | - | 2295 | WP_042946281.1 | type IV conjugative transfer system coupling protein TraD | - |
| C2U44_RS32035 | 61856..62383 | - | 528 | WP_032736843.1 | hypothetical protein | - |
| C2U44_RS32040 | 62394..65237 | - | 2844 | WP_032736845.1 | conjugal transfer mating pair stabilization protein TraG | - |
| C2U44_RS32045 | 65237..66607 | - | 1371 | WP_032736846.1 | conjugal transfer protein TraH | - |
| C2U44_RS32050 | 66594..67208 | - | 615 | WP_088912316.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
| C2U44_RS32055 | 67144..67380 | - | 237 | WP_032736848.1 | type-F conjugative transfer system pilin chaperone TraQ | - |
| C2U44_RS32060 | 67391..68143 | - | 753 | WP_042946285.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
| C2U44_RS32065 | 68164..68490 | - | 327 | WP_032736851.1 | hypothetical protein | - |
| C2U44_RS32070 | 68537..68722 | - | 186 | WP_032736852.1 | hypothetical protein | - |
| C2U44_RS32075 | 68719..68955 | - | 237 | WP_032736854.1 | conjugal transfer protein TrbE | - |
| C2U44_RS32080 | 68945..69556 | - | 612 | WP_032736855.1 | hypothetical protein | - |
| C2U44_RS32085 | 69670..71613 | - | 1944 | WP_042946286.1 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
| C2U44_RS32090 | 71610..72236 | - | 627 | WP_032736857.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
| C2U44_RS32095 | 72249..73241 | - | 993 | WP_032736858.1 | conjugal transfer pilus assembly protein TraU | - |
| C2U44_RS32100 | 73252..73878 | - | 627 | WP_042946288.1 | type-F conjugative transfer system protein TraW | - |
| C2U44_RS32105 | 73875..74264 | - | 390 | WP_032736860.1 | type-F conjugative transfer system protein TrbI | - |
| C2U44_RS32110 | 74264..76567 | - | 2304 | Protein_76 | type IV secretion system protein TraC | - |
| C2U44_RS32115 | 76653..77678 | + | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32120 | 77973..78941 | + | 969 | WP_031942297.1 | IS5-like element IS903B family transposase | - |
| C2U44_RS32125 | 79260..80285 | - | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS35620 | 80364..80717 | - | 354 | Protein_80 | TraC family protein | - |
| C2U44_RS32130 | 80810..81193 | - | 384 | WP_042946290.1 | hypothetical protein | - |
| C2U44_RS32135 | 81280..81579 | - | 300 | WP_032736863.1 | hypothetical protein | - |
| C2U44_RS32140 | 81576..81794 | - | 219 | WP_088912318.1 | hypothetical protein | - |
| C2U44_RS32145 | 82062..82340 | - | 279 | WP_042946291.1 | hypothetical protein | - |
| C2U44_RS32150 | 82452..83021 | - | 570 | WP_042946293.1 | type IV conjugative transfer system lipoprotein TraV | - |
| C2U44_RS35330 | 83041..83202 | - | 162 | WP_154235504.1 | hypothetical protein | - |
| C2U44_RS32155 | 83195..84616 | - | 1422 | WP_032736866.1 | conjugal transfer protein TraB | - |
| C2U44_RS32160 | 84616..85350 | - | 735 | WP_032736867.1 | type-F conjugative transfer system secretin TraK | - |
| C2U44_RS32165 | 85337..85903 | - | 567 | WP_032736869.1 | type IV conjugative transfer system protein TraE | - |
| C2U44_RS32170 | 85923..86159 | - | 237 | Protein_90 | type IV conjugative transfer system protein TraL | - |
| C2U44_RS32175 | 86193..89090 | - | 2898 | WP_001553819.1 | Tn3-like element Tn5403 family transposase | - |
| C2U44_RS32180 | 89185..89790 | + | 606 | WP_000509966.1 | recombinase family protein | - |
| C2U44_RS32185 | 89752..90304 | - | 553 | Protein_93 | IS5 family transposase | - |
| C2U44_RS32190 | 90599..91624 | - | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32195 | 91781..92466 | - | 686 | Protein_95 | IS1 family transposase | - |
| C2U44_RS32200 | 92625..94847 | - | 2223 | WP_020804634.1 | glycosyltransferase | - |
| C2U44_RS32205 | 94945..95754 | + | 810 | WP_000183578.1 | polysaccharide pyruvyl transferase family protein | - |
| C2U44_RS32210 | 96024..96662 | - | 639 | Protein_98 | transposase | - |
| C2U44_RS32215 | 96897..97922 | + | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32220 | 98241..99209 | - | 969 | WP_000654805.1 | IS5 family transposase | - |
| C2U44_RS32225 | 99504..100529 | - | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32230 | 100605..100802 | - | 198 | WP_047718110.1 | hypothetical protein | - |
| C2U44_RS32235 | 100981..101675 | - | 695 | Protein_103 | IS6 family transposase | - |
| C2U44_RS32240 | 102174..102497 | + | 324 | WP_017900603.1 | DUF1778 domain-containing protein | - |
| C2U44_RS32245 | 102481..103029 | + | 549 | WP_017900604.1 | GNAT family N-acetyltransferase | - |
| C2U44_RS32250 | 103294..103425 | - | 132 | Protein_106 | IS5/IS1182 family transposase | - |
| C2U44_RS32255 | 103532..106213 | - | 2682 | WP_032744126.1 | AAA family ATPase | - |
| C2U44_RS32265 | 106591..107616 | + | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32270 | 107935..108903 | - | 969 | WP_162492046.1 | IS5-like element IS903B family transposase | - |
| C2U44_RS32275 | 109198..110223 | - | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32280 | 110313..111245 | - | 933 | WP_020805035.1 | hypothetical protein | - |
| C2U44_RS32285 | 111249..112244 | - | 996 | WP_032744124.1 | hypothetical protein | - |
| C2U44_RS32295 | 112854..112997 | + | 144 | Protein_113 | transposase | - |
| C2U44_RS32300 | 113749..115941 | + | 2193 | WP_032743941.1 | 1,4-alpha-glucan branching enzyme | - |
| C2U44_RS32305 | 116071..117354 | + | 1284 | WP_032690514.1 | glucose-1-phosphate adenylyltransferase | - |
| C2U44_RS32310 | 117444..118877 | + | 1434 | WP_004197677.1 | glycogen synthase GlgA | - |
| C2U44_RS32315 | 118896..121343 | + | 2448 | WP_032690516.1 | glycogen phosphorylase | - |
| C2U44_RS32320 | 121448..123091 | + | 1644 | WP_004197675.1 | phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) | - |
| C2U44_RS32335 | 123617..124642 | + | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32340 | 124961..125929 | - | 969 | WP_162492046.1 | IS5-like element IS903B family transposase | - |
| C2U44_RS32345 | 126224..127249 | - | 1026 | WP_001101446.1 | IS110 family transposase | - |
| C2U44_RS32350 | 127337..127834 | + | 498 | Protein_122 | LuxR family transcriptional regulator | - |
| C2U44_RS32355 | 128169..128447 | + | 279 | WP_004197671.1 | hypothetical protein | - |
| C2U44_RS32360 | 128492..129189 | - | 698 | Protein_124 | IS1 family transposase | - |
| C2U44_RS32370 | 129246..129764 | - | 519 | Protein_125 | PLP-dependent transferase | - |
| C2U44_RS32375 | 129846..131123 | - | 1278 | WP_001515737.1 | serine dehydratase subunit alpha family protein | - |
| C2U44_RS32380 | 131471..132112 | - | 642 | WP_000948259.1 | membrane integrity-associated transporter subunit PqiC | - |
| C2U44_RS32385 | 132112..133050 | - | 939 | WP_000449980.1 | MCE family protein | - |
| C2U44_RS32390 | 133052..133843 | - | 792 | WP_001325019.1 | ABC transporter ATP-binding protein | - |
| C2U44_RS32395 | 133849..134994 | - | 1146 | WP_001325018.1 | ABC transporter permease | - |
| C2U44_RS32400 | 135237..135941 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| C2U44_RS32410 | 136084..136695 | - | 612 | Protein_132 | DUF4158 domain-containing protein | - |
| C2U44_RS32415 | 136854..137144 | + | 291 | WP_001247892.1 | nucleotidyltransferase | - |
| C2U44_RS32420 | 137141..137542 | + | 402 | WP_001293886.1 | DUF86 domain-containing protein | - |
| C2U44_RS32425 | 137532..137888 | + | 357 | WP_003465043.1 | cupin domain-containing protein | - |
| C2U44_RS32430 | 138143..138469 | + | 327 | WP_003100858.1 | hypothetical protein | - |
| C2U44_RS32435 | 138466..138966 | + | 501 | WP_003100856.1 | hypothetical protein | - |
| C2U44_RS32440 | 138963..139334 | + | 372 | WP_003100853.1 | hypothetical protein | - |
| C2U44_RS32445 | 139328..139885 | + | 558 | WP_003100847.1 | recombinase family protein | - |
| C2U44_RS32450 | 139964..140968 | + | 1005 | WP_000427623.1 | IS110-like element IS4321 family transposase | - |
| C2U44_RS32455 | 141150..141353 | - | 204 | WP_004197809.1 | hypothetical protein | - |
| C2U44_RS32460 | 141367..141570 | - | 204 | WP_004197808.1 | hemolysin expression modulator Hha | - |
| C2U44_RS32465 | 141604..141972 | - | 369 | WP_004197807.1 | hypothetical protein | - |
| C2U44_RS32470 | 142016..142510 | - | 495 | WP_020805591.1 | hypothetical protein | - |
| C2U44_RS32475 | 142541..143113 | - | 573 | WP_103433631.1 | hypothetical protein | - |
| C2U44_RS32480 | 143110..143358 | - | 249 | WP_000272716.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaKPC-2 | - | 1..144055 | 144055 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T93777 WP_013023785.1 NZ_CP026272:119-424 [Klebsiella oxytoca]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
>T93777 NZ_CP026272:119-424 [Klebsiella oxytoca]
ATGCAGTTTAAGGTTTATGCCTATAAAAGAGAGAGCCGCTATCGTCTGTTCGTGGATGTGCAGAGTGACATCATCGATAC
CCCCGGGCGACGGATGGTGATCCCGCTGGCCAGCGCCCGGCTGCTGTCGGATAAGGTTTCCCGTGAACTCTATCCGGTGG
TGCACATCGGGGATGAAAGCTACCGCCTGATGACCACGGACATGGCCAGCGTCACGTCCTCCGTCACCGGGGAGGAAGTG
GCCGATCTCAGCCACCGGGAAAATGACATCAAAAATGCGATAAACCTGATGTTCTGGGGAATTTGA
ATGCAGTTTAAGGTTTATGCCTATAAAAGAGAGAGCCGCTATCGTCTGTTCGTGGATGTGCAGAGTGACATCATCGATAC
CCCCGGGCGACGGATGGTGATCCCGCTGGCCAGCGCCCGGCTGCTGTCGGATAAGGTTTCCCGTGAACTCTATCCGGTGG
TGCACATCGGGGATGAAAGCTACCGCCTGATGACCACGGACATGGCCAGCGTCACGTCCTCCGTCACCGGGGAGGAAGTG
GCCGATCTCAGCCACCGGGAAAATGACATCAAAAATGCGATAAACCTGATGTTCTGGGGAATTTGA
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |