Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1..246324 | Replicon | plasmid pJYC04A |
| Accession | NZ_CP022917 | ||
| Organism | Klebsiella pneumoniae strain ST307PT04 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | CJ257_RS26450 | Protein ID | WP_003026803.1 |
| Coordinates | 1..483 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | CJ257_RS26445 | Protein ID | WP_003026799.1 |
| Coordinates | 246324..13 (+) | Length | -82103.333333333 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CJ257_RS26450 | 1..483 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| CJ257_RS26455 | 691..2037 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| CJ257_RS26460 | 2086..2481 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| CJ257_RS26465 | 2629..3883 | - | 1255 | Protein_4 | IS3 family transposase | - |
| CJ257_RS26470 | 3971..4933 | - | 963 | WP_004152113.1 | M48 family metalloprotease | - |
| CJ257_RS26475 | 4920..5669 | - | 750 | WP_009483782.1 | phosphate-starvation-inducible PsiE family protein | - |
| CJ257_RS26485 | 5907..6104 | - | 198 | WP_004152115.1 | hypothetical protein | - |
| CJ257_RS26490 | 6104..8899 | - | 2796 | WP_004152116.1 | heat shock survival AAA family ATPase ClpK | - |
| CJ257_RS26495 | 9023..9592 | - | 570 | WP_004152117.1 | small heat shock protein sHSP20 | - |
| CJ257_RS26500 | 9627..9908 | - | 282 | WP_004152118.1 | helix-turn-helix domain-containing protein | - |
| CJ257_RS29035 | 10152..10415 | - | 264 | WP_004118208.1 | hypothetical protein | - |
| CJ257_RS29040 | 10430..10693 | + | 264 | WP_004118209.1 | transposase | - |
| CJ257_RS26510 | 10638..10754 | + | 117 | Protein_13 | transposase domain-containing protein | - |
| CJ257_RS26515 | 10939..11636 | + | 698 | Protein_14 | IS1 family transposase | - |
| CJ257_RS26520 | 11844..12851 | - | 1008 | WP_004181997.1 | formamidase | - |
| CJ257_RS26525 | 12887..13576 | - | 690 | WP_004181996.1 | urea ABC transporter ATP-binding subunit UrtE | - |
| CJ257_RS26530 | 13587..14336 | - | 750 | WP_004181995.1 | urea ABC transporter ATP-binding protein UrtD | - |
| CJ257_RS26535 | 14333..15448 | - | 1116 | WP_004181994.1 | urea ABC transporter permease subunit UrtC | - |
| CJ257_RS26540 | 15458..16384 | - | 927 | WP_004181993.1 | urea ABC transporter permease subunit UrtB | - |
| CJ257_RS26545 | 16441..17631 | - | 1191 | WP_004197507.1 | urea ABC transporter substrate-binding protein | - |
| CJ257_RS26550 | 17936..21316 | + | 3381 | WP_004181991.1 | response regulator | - |
| CJ257_RS26555 | 21279..22199 | + | 921 | WP_004181990.1 | response regulator | - |
| CJ257_RS26560 | 22251..22715 | + | 465 | Protein_23 | transposase | - |
| CJ257_RS26565 | 22759..23139 | - | 381 | Protein_24 | transposase family protein | - |
| CJ257_RS26570 | 23196..24164 | - | 969 | WP_072143344.1 | IS5 family transposase | - |
| CJ257_RS26575 | 24438..25442 | + | 1005 | WP_000427619.1 | IS110-like element IS5075 family transposase | - |
| CJ257_RS26580 | 25624..25800 | - | 177 | WP_000954592.1 | Arm DNA-binding domain-containing protein | - |
| CJ257_RS26590 | 26130..26945 | + | 816 | WP_001043260.1 | sulfonamide-resistant dihydropteroate synthase Sul2 | - |
| CJ257_RS26595 | 27006..27809 | + | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| CJ257_RS26600 | 27809..28645 | + | 837 | WP_000480968.1 | aminoglycoside O-phosphotransferase APH(6)-Id | - |
| CJ257_RS26605 | 28727..29431 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| CJ257_RS26615 | 29481..29639 | + | 159 | Protein_32 | class A beta-lactamase | - |
| CJ257_RS26620 | 29849..30253 | + | 405 | Protein_33 | IS91 family transposase | - |
| CJ257_RS26630 | 30402..31106 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| CJ257_RS26640 | 31652..32665 | - | 1014 | WP_000845048.1 | class 1 integron integrase IntI1 | - |
| CJ257_RS26645 | 32821..33294 | + | 474 | WP_004201280.1 | trimethoprim-resistant dihydrofolate reductase DfrA14 | - |
| CJ257_RS26650 | 33515..33781 | + | 267 | WP_001144737.1 | plasmid mobilization relaxosome protein MobC | - |
| CJ257_RS26660 | 33924..34688 | + | 765 | WP_001389365.1 | IS6-like element IS6100 family transposase | - |
| CJ257_RS26675 | 34949..36163 | + | 1215 | WP_004098817.1 | type II site-specific deoxyribonuclease | - |
| CJ257_RS26680 | 36197..37600 | - | 1404 | WP_072094655.1 | DNA cytosine methyltransferase | - |
| CJ257_RS26685 | 37729..37914 | + | 186 | Protein_41 | IS1 family transposase | - |
| CJ257_RS26695 | 37949..38653 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| CJ257_RS26700 | 38719..40233 | + | 1515 | Protein_43 | Tn3-like element TnAs1 family transposase | - |
| CJ257_RS26705 | 40275..40517 | + | 243 | WP_032140899.1 | hypothetical protein | - |
| CJ257_RS26710 | 40549..41199 | - | 651 | WP_000164043.1 | tetracycline resistance transcriptional repressor TetR(A) | - |
| CJ257_RS26715 | 41305..42504 | + | 1200 | WP_000804064.1 | tetracycline efflux MFS transporter Tet(A) | - |
| CJ257_RS26720 | 42536..43420 | - | 885 | WP_000058717.1 | EamA family transporter | - |
| CJ257_RS26725 | 43558..43965 | - | 408 | WP_001214976.1 | cysteine hydrolase | - |
| CJ257_RS26730 | 43954..44703 | + | 750 | Protein_49 | Tn3 family transposase | - |
| CJ257_RS26735 | 44727..45332 | - | 606 | WP_000509965.1 | recombinase family protein | - |
| CJ257_RS26740 | 45427..48324 | + | 2898 | WP_001553819.1 | Tn3-like element Tn5403 family transposase | - |
| CJ257_RS26745 | 48359..50161 | + | 1803 | Protein_52 | Tn3-like element IS3000 family transposase | - |
| CJ257_RS26750 | 50237..50638 | + | 402 | Protein_53 | phage shock protein operon transcriptional activator | - |
| CJ257_RS26755 | 50732..51376 | + | 645 | WP_014386481.1 | quinolone resistance pentapeptide repeat protein QnrB1 | - |
| CJ257_RS26760 | 51468..52121 | - | 654 | Protein_55 | SDR family oxidoreductase | - |
| CJ257_RS26765 | 52176..52880 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| CJ257_RS26770 | 52945..54195 | - | 1251 | Protein_57 | transposase | - |
| CJ257_RS26780 | 54270..54938 | - | 669 | WP_001300294.1 | EAL domain-containing protein | - |
| CJ257_RS26785 | 54974..55210 | - | 237 | WP_000993386.1 | broad-spectrum mercury transporter MerE | - |
| CJ257_RS26790 | 55207..55569 | - | 363 | WP_001277456.1 | mercury resistance co-regulator MerD | - |
| CJ257_RS26795 | 55587..57281 | - | 1695 | WP_000105636.1 | mercury(II) reductase | - |
| CJ257_RS26800 | 57333..57755 | - | 423 | WP_001340589.1 | organomercurial transporter MerC | - |
| CJ257_RS26805 | 57791..57901 | - | 111 | Protein_63 | mercuric transport protein periplasmic component | - |
| CJ257_RS26810 | 57917..58614 | - | 698 | Protein_64 | IS1 family transposase | - |
| CJ257_RS26815 | 58648..59358 | - | 711 | WP_004152334.1 | ATP-binding protein | - |
| CJ257_RS26820 | 59432..59848 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | - |
| CJ257_RS26825 | 59845..60075 | - | 231 | WP_001261282.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| CJ257_RS26830 | 60032..60493 | + | 462 | WP_072093212.1 | hypothetical protein | - |
| CJ257_RS26840 | 60980..61288 | + | 309 | WP_004152336.1 | hypothetical protein | - |
| CJ257_RS26845 | 61316..61645 | + | 330 | WP_004152337.1 | hypothetical protein | - |
| CJ257_RS26850 | 61671..62069 | + | 399 | WP_004171440.1 | hypothetical protein | - |
| CJ257_RS26855 | 62076..62408 | + | 333 | WP_004152339.1 | hypothetical protein | - |
| CJ257_RS26860 | 62408..63190 | + | 783 | WP_119948544.1 | site-specific integrase | - |
| CJ257_RS26865 | 64082..64312 | - | 231 | WP_011977773.1 | hypothetical protein | - |
| CJ257_RS26870 | 64404..64877 | - | 474 | WP_004152341.1 | YkgJ family cysteine cluster protein | - |
| CJ257_RS26875 | 64997..66265 | - | 1269 | WP_004152342.1 | ISL3-like element ISKpn25 family transposase | - |
| CJ257_RS26880 | 66270..69527 | - | 3258 | WP_004152343.1 | type I restriction endonuclease subunit R | - |
| CJ257_RS26885 | 69528..70844 | - | 1317 | WP_004152344.1 | restriction endonuclease subunit S | - |
| CJ257_RS26890 | 70841..72868 | - | 2028 | WP_004152345.1 | type I restriction-modification system subunit M | - |
| CJ257_RS26895 | 72980..73195 | - | 216 | WP_004227314.1 | hypothetical protein | - |
| CJ257_RS26900 | 73420..73752 | - | 333 | WP_004152347.1 | hypothetical protein | - |
| CJ257_RS26910 | 74129..75103 | - | 975 | WP_004152348.1 | ParB/RepB/Spo0J family partition protein | - |
| CJ257_RS26915 | 75100..76305 | - | 1206 | WP_004152349.1 | AAA family ATPase | - |
| CJ257_RS26920 | 76627..77523 | - | 897 | WP_004152350.1 | RepB family plasmid replication initiator protein | - |
| CJ257_RS26925 | 77924..79195 | - | 1272 | WP_004152351.1 | Y-family DNA polymerase | - |
| CJ257_RS26930 | 79195..79626 | - | 432 | WP_004152352.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| CJ257_RS26935 | 79858..80829 | + | 972 | WP_004152353.1 | mediator of plasmid stability | - |
| CJ257_RS26940 | 80832..81503 | + | 672 | WP_004152354.1 | plasmid partitioning/stability family protein | - |
| CJ257_RS26945 | 81564..81794 | + | 231 | WP_001568040.1 | hypothetical protein | - |
| CJ257_RS26955 | 82231..82932 | + | 702 | WP_004152355.1 | DNA methylase | - |
| CJ257_RS26960 | 82932..83153 | + | 222 | WP_001568042.1 | hypothetical protein | - |
| CJ257_RS26965 | 83163..83582 | + | 420 | WP_001568043.1 | DUF1380 domain-containing protein | - |
| CJ257_RS26970 | 83636..84403 | + | 768 | WP_119948546.1 | hypothetical protein | - |
| CJ257_RS29225 | 85083..85511 | + | 429 | WP_004152356.1 | antirestriction protein | - |
| CJ257_RS26980 | 85554..86060 | + | 507 | WP_001568046.1 | antirestriction protein ArdA | - |
| CJ257_RS26985 | 86103..86294 | + | 192 | WP_001568047.1 | hypothetical protein | - |
| CJ257_RS26990 | 86482..86736 | + | 255 | WP_011977779.1 | DNA polymerase III subunit theta | - |
| CJ257_RS26995 | 86771..87088 | + | 318 | WP_004118473.1 | hypothetical protein | - |
| CJ257_RS27010 | 87872..88099 | + | 228 | WP_004152790.1 | hypothetical protein | - |
| CJ257_RS27015 | 88191..88421 | + | 231 | WP_001568051.1 | hypothetical protein | - |
| CJ257_RS27020 | 88473..89828 | + | 1356 | WP_032418010.1 | DUF3560 domain-containing protein | - |
| CJ257_RS27025 | 89876..90439 | + | 564 | WP_080884163.1 | methyltransferase | - |
| CJ257_RS27040 | 91270..91812 | + | 543 | WP_073558210.1 | single-stranded DNA-binding protein | - |
| CJ257_RS27045 | 91861..92109 | + | 249 | WP_032431380.1 | DUF905 domain-containing protein | - |
| CJ257_RS27050 | 92179..94236 | + | 2058 | WP_119918748.1 | ParB/RepB/Spo0J family partition protein | - |
| CJ257_RS27055 | 94281..94712 | + | 432 | WP_004194235.1 | conjugation system SOS inhibitor PsiB | - |
| CJ257_RS27060 | 94709..95437 | + | 729 | WP_001568058.1 | plasmid SOS inhibition protein A | - |
| CJ257_RS27065 | 95434..95760 | + | 327 | WP_001568059.1 | hypothetical protein | - |
| CJ257_RS27070 | 95816..96190 | + | 375 | WP_119918746.1 | hypothetical protein | - |
| CJ257_RS27080 | 96368..97447 | - | 1080 | WP_004220208.1 | IS481-like element ISKpn28 family transposase | - |
| CJ257_RS27085 | 97519..97677 | + | 159 | WP_014343509.1 | type I toxin-antitoxin system Hok family toxin | - |
| CJ257_RS27095 | 98370..98642 | + | 273 | WP_032445785.1 | hypothetical protein | - |
| CJ257_RS27100 | 98639..98989 | + | 351 | WP_032445787.1 | hypothetical protein | - |
| CJ257_RS27105 | 99004..99321 | + | 318 | WP_032445789.1 | hypothetical protein | - |
| CJ257_RS27110 | 100161..100517 | + | 357 | WP_019706019.1 | hypothetical protein | - |
| CJ257_RS27115 | 100578..100790 | + | 213 | WP_032445756.1 | hypothetical protein | - |
| CJ257_RS27120 | 100801..101025 | + | 225 | WP_014343499.1 | hypothetical protein | - |
| CJ257_RS27125 | 101106..101426 | + | 321 | WP_004152720.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| CJ257_RS27130 | 101416..101694 | + | 279 | WP_004152721.1 | helix-turn-helix domain-containing protein | - |
| CJ257_RS27135 | 101695..102108 | + | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
| CJ257_RS27150 | 102825..103205 | + | 381 | WP_020802391.1 | hypothetical protein | - |
| CJ257_RS27155 | 103272..103619 | + | 348 | WP_032445771.1 | hypothetical protein | - |
| CJ257_RS27160 | 103714..103860 | + | 147 | WP_004152750.1 | hypothetical protein | - |
| CJ257_RS27165 | 103911..104744 | + | 834 | WP_032445769.1 | N-6 DNA methylase | - |
| CJ257_RS27175 | 105560..106381 | + | 822 | WP_004152492.1 | DUF945 domain-containing protein | - |
| CJ257_RS27180 | 106414..106743 | + | 330 | WP_011977736.1 | hypothetical protein | - |
| CJ257_RS27185 | 106776..107261 | - | 486 | WP_001568108.1 | transglycosylase SLT domain-containing protein | - |
| CJ257_RS27190 | 107683..108081 | + | 399 | WP_004152493.1 | relaxosome protein TraM | - |
| CJ257_RS27195 | 108255..108941 | + | 687 | WP_004152494.1 | transcriptional regulator TraJ family protein | - |
| CJ257_RS27200 | 109020..109406 | + | 387 | WP_004152495.1 | TraY domain-containing protein | - |
| CJ257_RS27205 | 109460..109828 | + | 369 | WP_004152496.1 | type IV conjugative transfer system pilin TraA | - |
| CJ257_RS27210 | 109842..110147 | + | 306 | WP_004144424.1 | type IV conjugative transfer system protein TraL | - |
| CJ257_RS27215 | 110167..110733 | + | 567 | WP_004144423.1 | type IV conjugative transfer system protein TraE | - |
| CJ257_RS27220 | 110720..111460 | + | 741 | WP_004152497.1 | type-F conjugative transfer system secretin TraK | - |
| CJ257_RS27225 | 111460..112884 | + | 1425 | WP_004155033.1 | conjugal transfer protein TraB | - |
| CJ257_RS27230 | 112998..113582 | + | 585 | WP_004161368.1 | type IV conjugative transfer system lipoprotein TraV | - |
| CJ257_RS27235 | 113714..114124 | + | 411 | WP_004152499.1 | hypothetical protein | - |
| CJ257_RS27240 | 114230..114448 | + | 219 | WP_004152501.1 | hypothetical protein | - |
| CJ257_RS27245 | 114449..114760 | + | 312 | WP_004152502.1 | hypothetical protein | - |
| CJ257_RS27250 | 114827..115231 | + | 405 | WP_004152503.1 | hypothetical protein | - |
| CJ257_RS29230 | 115274..115663 | + | 390 | WP_004153076.1 | hypothetical protein | - |
| CJ257_RS27260 | 115671..116069 | + | 399 | WP_011977783.1 | hypothetical protein | - |
| CJ257_RS27265 | 116141..118780 | + | 2640 | WP_004152505.1 | type IV secretion system protein TraC | - |
| CJ257_RS27270 | 118780..119169 | + | 390 | WP_004152506.1 | type-F conjugative transfer system protein TrbI | - |
| CJ257_RS27275 | 119169..119795 | + | 627 | WP_004152507.1 | type-F conjugative transfer system protein TraW | - |
| CJ257_RS27280 | 119837..120226 | + | 390 | WP_004152508.1 | hypothetical protein | - |
| CJ257_RS27285 | 120223..121212 | + | 990 | WP_011977785.1 | conjugal transfer pilus assembly protein TraU | - |
| CJ257_RS27290 | 121225..121863 | + | 639 | WP_011977786.1 | type-F conjugative transfer system pilin assembly protein TrbC | - |
| CJ257_RS27295 | 121922..123877 | + | 1956 | WP_004152673.1 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
| CJ257_RS27300 | 123909..124163 | + | 255 | WP_004152674.1 | conjugal transfer protein TrbE | - |
| CJ257_RS27305 | 124141..124389 | + | 249 | WP_004152675.1 | hypothetical protein | - |
| CJ257_RS27310 | 124402..124728 | + | 327 | WP_004152676.1 | hypothetical protein | - |
| CJ257_RS27315 | 124749..125501 | + | 753 | WP_004152677.1 | type-F conjugative transfer system pilin assembly protein TraF | - |
| CJ257_RS27320 | 125512..125751 | + | 240 | WP_004144400.1 | type-F conjugative transfer system pilin chaperone TraQ | - |
| CJ257_RS27325 | 125723..126280 | + | 558 | WP_013214031.1 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | - |
| CJ257_RS27330 | 126326..126769 | + | 444 | WP_004152679.1 | F-type conjugal transfer protein TrbF | - |
| CJ257_RS27335 | 126747..128126 | + | 1380 | WP_162921998.1 | conjugal transfer protein TraH | - |
| CJ257_RS27340 | 128126..130975 | + | 2850 | WP_004152624.1 | conjugal transfer mating pair stabilization protein TraG | - |
| CJ257_RS27345 | 130988..131536 | + | 549 | WP_004152623.1 | conjugal transfer entry exclusion protein TraS | - |
| CJ257_RS27350 | 131720..132451 | + | 732 | WP_004152622.1 | complement resistance protein TraT | - |
| CJ257_RS29110 | 132643..133332 | + | 690 | WP_004198206.1 | hypothetical protein | - |
| CJ257_RS27360 | 133461..135773 | + | 2313 | Protein_162 | type IV conjugative transfer system coupling protein TraD | - |
| CJ257_RS27365 | 135773..141034 | + | 5262 | WP_119918742.1 | conjugative transfer relaxase/helicase TraI | - |
| CJ257_RS27370 | 141115..141840 | + | 726 | WP_004152379.1 | type-F conjugative transfer system pilin acetylase TraX | - |
| CJ257_RS27375 | 141912..142505 | + | 594 | WP_004152380.1 | fertility inhibition protein FinO | - |
| CJ257_RS27380 | 142666..143268 | + | 603 | WP_015060010.1 | hypothetical protein | - |
| CJ257_RS27385 | 143318..143962 | + | 645 | WP_004153014.1 | hypothetical protein | - |
| CJ257_RS27390 | 144018..144668 | + | 651 | WP_004152382.1 | DUF2726 domain-containing protein | - |
| CJ257_RS27395 | 144665..144973 | + | 309 | WP_004152383.1 | hypothetical protein | - |
| CJ257_RS27400 | 145149..145628 | + | 480 | WP_014343478.1 | phospholipase D family protein | - |
| CJ257_RS27405 | 145746..146015 | + | 270 | WP_013609506.1 | replication regulatory protein RepA | - |
| CJ257_RS27410 | 146247..146324 | + | 78 | WP_004171450.1 | RepA leader peptide Tap | - |
| CJ257_RS27415 | 146317..147174 | + | 858 | WP_004152386.1 | incFII family plasmid replication initiator RepA | - |
| CJ257_RS27430 | 148393..148956 | + | 564 | WP_004152388.1 | hypothetical protein | - |
| CJ257_RS27435 | 148940..149551 | + | 612 | WP_004152389.1 | DUF2913 family protein | - |
| CJ257_RS29120 | 149760..149921 | - | 162 | WP_004152390.1 | hypothetical protein | - |
| CJ257_RS27440 | 149948..150940 | - | 993 | WP_001145103.1 | hypothetical protein | - |
| CJ257_RS29125 | 150989..151144 | - | 156 | WP_001404092.1 | hypothetical protein | - |
| CJ257_RS27445 | 151439..153154 | - | 1716 | WP_004152391.1 | Tn3-like element Tn4401 family resolvase TnpR | - |
| CJ257_RS27450 | 153264..156293 | + | 3030 | WP_004152392.1 | Tn3-like element Tn4401 family transposase | - |
| CJ257_RS27455 | 156400..157425 | + | 1026 | WP_004199214.1 | IS21 family transposase | - |
| CJ257_RS27460 | 157422..158201 | + | 780 | WP_004152394.1 | IS21-like element ISKpn7 family helper ATPase IstB | - |
| CJ257_RS27470 | 158489..159370 | + | 882 | WP_004199234.1 | carbapenem-hydrolyzing class A beta-lactamase KPC-2 | - |
| CJ257_RS27475 | 159620..160939 | - | 1320 | WP_004152397.1 | IS1182-like element ISKpn6 family transposase | - |
| CJ257_RS27480 | 161216..162400 | - | 1185 | WP_004152398.1 | ISAs1-like element ISKpn31 family transposase | - |
| CJ257_RS27485 | 162502..162732 | + | 231 | Protein_186 | IS5/IS1182 family transposase | - |
| CJ257_RS27490 | 162904..163263 | + | 360 | WP_004152400.1 | DUF305 domain-containing protein | - |
| CJ257_RS27495 | 163920..164330 | - | 411 | WP_004152401.1 | hypothetical protein | - |
| CJ257_RS27500 | 164429..165049 | - | 621 | WP_004152402.1 | recombinase family protein | - |
| CJ257_RS27505 | 165138..168035 | - | 2898 | WP_023307208.1 | Tn3-like element Tn5403 family transposase | - |
| CJ257_RS27510 | 168108..168812 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| CJ257_RS27515 | 168862..168972 | + | 111 | Protein_192 | ANT(3'') family aminoglycoside nucleotidyltransferase | - |
| CJ257_RS27520 | 169032..169856 | + | 825 | Protein_193 | class D beta-lactamase | - |
| CJ257_RS27525 | 170056..170373 | + | 318 | Protein_194 | recombinase family protein | - |
| CJ257_RS27530 | 170556..171416 | + | 861 | WP_000027057.1 | class A broad-spectrum beta-lactamase TEM-1 | - |
| CJ257_RS27535 | 171566..171937 | - | 372 | Protein_196 | IS6-like element IS26 family transposase | - |
| CJ257_RS27545 | 172117..172680 | - | 564 | WP_004182054.1 | methyltransferase | - |
| CJ257_RS27550 | 172728..174083 | - | 1356 | WP_004182052.1 | DUF3560 domain-containing protein | - |
| CJ257_RS27555 | 174135..174365 | - | 231 | WP_001568051.1 | hypothetical protein | - |
| CJ257_RS27560 | 174457..174684 | - | 228 | WP_004182050.1 | hypothetical protein | - |
| CJ257_RS27565 | 175411..175728 | - | 318 | WP_004118473.1 | hypothetical protein | - |
| CJ257_RS27570 | 175763..176017 | - | 255 | WP_023157779.1 | DNA polymerase III subunit theta | - |
| CJ257_RS27575 | 176254..176679 | - | 426 | WP_004118478.1 | antirestriction protein | - |
| CJ257_RS27585 | 177199..177429 | - | 231 | WP_004118481.1 | hypothetical protein | - |
| CJ257_RS27590 | 177663..179174 | - | 1512 | WP_160553108.1 | group II intron reverse transcriptase/maturase | - |
| CJ257_RS27600 | 179576..180001 | + | 426 | WP_004182047.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| CJ257_RS27605 | 180001..181272 | + | 1272 | WP_023157784.1 | Y-family DNA polymerase | - |
| CJ257_RS27610 | 181351..181602 | + | 252 | WP_004182043.1 | hypothetical protein | - |
| CJ257_RS27615 | 181847..183799 | - | 1953 | WP_000037308.1 | DUF262 domain-containing HNH endonuclease family protein | - |
| CJ257_RS27620 | 183796..185076 | - | 1281 | WP_004182042.1 | DUF262 domain-containing protein | - |
| CJ257_RS27630 | 186044..186739 | + | 696 | Protein_211 | IS1 family transposase | - |
| CJ257_RS27635 | 187514..188633 | - | 1120 | Protein_212 | IS3 family transposase | - |
| CJ257_RS27645 | 189762..190733 | - | 972 | WP_004182039.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| CJ257_RS27650 | 190733..191899 | - | 1167 | WP_004182032.1 | plasmid-partitioning protein SopA | - |
| CJ257_RS27655 | 192651..193661 | + | 1011 | WP_004182030.1 | RepB family plasmid replication initiator protein | - |
| CJ257_RS27660 | 194379..195119 | - | 741 | WP_001515717.1 | tyrosine-type recombinase/integrase | - |
| CJ257_RS27665 | 196263..197210 | + | 948 | WP_032430723.1 | sensor domain-containing diguanylate cyclase | - |
| CJ257_RS27670 | 197237..197548 | - | 312 | WP_071527918.1 | EAL domain-containing protein | - |
| CJ257_RS27680 | 197568..198536 | + | 969 | WP_068814619.1 | IS5 family transposase | - |
| CJ257_RS27685 | 199209..199466 | - | 258 | WP_004197688.1 | hypothetical protein | - |
| CJ257_RS27690 | 200086..201522 | + | 1437 | WP_080895248.1 | EAL domain-containing protein | - |
| CJ257_RS27695 | 202505..203782 | - | 1278 | WP_004152070.1 | DUF2254 domain-containing protein | - |
| CJ257_RS27700 | 203845..205842 | - | 1998 | WP_004178088.1 | choline BCCT transporter BetT | - |
| CJ257_RS27705 | 205994..206691 | - | 698 | Protein_224 | IS1 family transposase | - |
| CJ257_RS27720 | 208180..208664 | + | 485 | Protein_226 | IS1 family transposase | - |
| CJ257_RS27725 | 208680..209222 | + | 543 | Protein_227 | transposase | - |
| CJ257_RS27730 | 209518..209949 | - | 432 | WP_004178091.1 | silver-binding protein SilE | - |
| CJ257_RS27735 | 210200..211675 | - | 1476 | WP_003032875.1 | copper/silver sensor histidine kinase SilS | - |
| CJ257_RS27740 | 211668..212348 | - | 681 | WP_001572351.1 | copper/silver response regulator transcription factor SilR | - |
| CJ257_RS27745 | 212538..213923 | + | 1386 | WP_000475512.1 | Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC | - |
| CJ257_RS27750 | 213952..214305 | + | 354 | WP_001246153.1 | cation efflux system protein CusF | - |
| CJ257_RS27755 | 214419..215711 | + | 1293 | WP_004098959.1 | Cu(+)/Ag(+) efflux RND transporter periplasmic adaptor subunit SilB | - |
| CJ257_RS27760 | 215722..218868 | + | 3147 | WP_004098958.1 | Cu(+)/Ag(+) efflux RND transporter permease subunit SilA | - |
| CJ257_RS27765 | 218955..219395 | + | 441 | WP_000758228.1 | hypothetical protein | - |
| CJ257_RS27770 | 219522..221975 | + | 2454 | WP_023317528.1 | Ag(+)-translocating P-type ATPase SilP | - |
| CJ257_RS27775 | 222016..222213 | + | 198 | WP_000843497.1 | DUF2933 domain-containing protein | - |
| CJ257_RS27780 | 222247..222984 | - | 738 | WP_004182013.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| CJ257_RS27785 | 223273..223722 | - | 450 | WP_001023257.1 | copper resistance protein | - |
| CJ257_RS27790 | 223956..225773 | + | 1818 | WP_000925242.1 | multicopper oxidase PcoA | - |
| CJ257_RS27795 | 225779..226669 | + | 891 | WP_001378118.1 | copper resistance outer membrane transporter PcoB | - |
| CJ257_RS27800 | 226709..227089 | + | 381 | WP_000025662.1 | copper resistance system metallochaperone PcoC | - |
| CJ257_RS27805 | 227094..228023 | + | 930 | WP_004118344.1 | copper resistance inner membrane protein PcoD | - |
| CJ257_RS27810 | 228078..228758 | + | 681 | WP_001188930.1 | copper response regulator transcription factor PcoR | - |
| CJ257_RS27815 | 228755..230155 | + | 1401 | WP_004152084.1 | copper resistance membrane spanning protein PcoS | - |
| CJ257_RS27820 | 230372..230806 | + | 435 | WP_004152085.1 | copper resistance system metallochaperone PcoE | - |
| CJ257_RS27825 | 231038..231217 | - | 180 | WP_024623170.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| CJ257_RS27830 | 231278..232898 | - | 1621 | Protein_248 | ISL3 family transposase | - |
| CJ257_RS27835 | 232960..233469 | + | 510 | WP_004196769.1 | aquaporin | - |
| CJ257_RS27840 | 233519..234016 | - | 498 | WP_004196778.1 | GNAT family N-acetyltransferase | - |
| CJ257_RS27845 | 234348..234674 | + | 327 | WP_004152092.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| CJ257_RS27850 | 234671..235384 | + | 714 | WP_004182006.1 | arsenical resistance protein ArsH | - |
| CJ257_RS27855 | 235393..235938 | + | 546 | WP_004182005.1 | sigma-70 family RNA polymerase sigma factor | - |
| CJ257_RS27860 | 236014..236376 | + | 363 | WP_004152095.1 | arsenic metallochaperone ArsD family protein | - |
| CJ257_RS27865 | 236401..238151 | + | 1751 | Protein_255 | arsenical pump-driving ATPase | - |
| CJ257_RS27870 | 238273..238809 | + | 537 | WP_004152096.1 | GNAT family N-acetyltransferase | - |
| CJ257_RS27875 | 238842..239267 | - | 426 | WP_004152097.1 | glutaredoxin-dependent arsenate reductase | - |
| CJ257_RS27880 | 239280..240569 | - | 1290 | WP_004152098.1 | arsenite efflux transporter membrane subunit ArsB | - |
| CJ257_RS27885 | 240617..242368 | - | 1752 | WP_004152099.1 | arsenite efflux transporter ATPase subunit ArsA | - |
| CJ257_RS27890 | 242386..242748 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| CJ257_RS27895 | 242798..243148 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| CJ257_RS27900 | 243506..243775 | + | 270 | WP_004152102.1 | hypothetical protein | - |
| CJ257_RS27905 | 243763..244338 | + | 576 | WP_004152103.1 | hypothetical protein | - |
| CJ257_RS27910 | 244369..244863 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
| CJ257_RS27915 | 244907..245275 | + | 369 | WP_004152105.1 | hypothetical protein | - |
| CJ257_RS27920 | 245309..245512 | + | 204 | WP_004152106.1 | hemolysin expression modulator Hha | - |
| CJ257_RS27925 | 245561..245818 | + | 258 | WP_004152107.1 | hypothetical protein | - |
| CJ257_RS27930 | 245894..246148 | + | 255 | WP_004152108.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / dfrA14 / tet(A) / qnrB1 / blaKPC-2 / blaOXA-9 / blaTEM-1A | - | 1..246577 | 246577 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T80178 WP_003026803.1 NZ_CP022917:1-483 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
>T80178 NZ_CP022917:1-483 [Klebsiella pneumoniae]
GTGGGACGTATAACCACGCCCGAGCCGTTATCCAGCTCTCATCAGCTGGCTGAGTTCGTCAGTGGAGAGACAGTCCTCGA
TGAATGGCTAAAACAGAGAGGTTTAAAAAATCAAGCTCTTGGCGCTGCCCGAACGTTCGTTGTTTGCAAGACGGGTACGA
AGCAAGTAGCTGGTTTTTACTCTTTGGCCACCGGTAGCGTTAACCATACGGAAGCGACAGGTAGTCTTCGGCGTAACATG
CCAGATCCTATACCGGTGATTATACTCGCTCGCCTGGCGGTAGATGTCTCATTGCACGGAAAAGGGGTTGGCGCCGATTT
ACTCCACGATGCAGTTCTACGGTGTTATCGCGTAGCTGAGAACATTGGGGTTCGTGCGATAATGGTTCATGCGCTTACTG
AAGAAGCCAAAGGTTTCTATGCTCACCATGGATTTAAGGCATCACAAACTCATGAGAGGACTCTGTTTCTAAAGCTTCCA
TGA
GTGGGACGTATAACCACGCCCGAGCCGTTATCCAGCTCTCATCAGCTGGCTGAGTTCGTCAGTGGAGAGACAGTCCTCGA
TGAATGGCTAAAACAGAGAGGTTTAAAAAATCAAGCTCTTGGCGCTGCCCGAACGTTCGTTGTTTGCAAGACGGGTACGA
AGCAAGTAGCTGGTTTTTACTCTTTGGCCACCGGTAGCGTTAACCATACGGAAGCGACAGGTAGTCTTCGGCGTAACATG
CCAGATCCTATACCGGTGATTATACTCGCTCGCCTGGCGGTAGATGTCTCATTGCACGGAAAAGGGGTTGGCGCCGATTT
ACTCCACGATGCAGTTCTACGGTGTTATCGCGTAGCTGAGAACATTGGGGTTCGTGCGATAATGGTTCATGCGCTTACTG
AAGAAGCCAAAGGTTTCTATGCTCACCATGGATTTAAGGCATCACAAACTCATGAGAGGACTCTGTTTCTAAAGCTTCCA
TGA
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |