Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1654161..1654755 | Replicon | chromosome |
Accession | NZ_CP020384 | ||
Organism | Rhodovulum sp. MB263 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | B5V46_RS07835 | Protein ID | WP_080616079.1 |
Coordinates | 1654161..1654346 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | B5V46_RS07840 | Protein ID | WP_080616080.1 |
Coordinates | 1654363..1654755 (+) | Length | 131 a.a. |
Genomic Context
Location: 1649524..1650408 (885 bp)
Type: Others
Protein ID: WP_080617988.1
Type: Others
Protein ID: WP_080617988.1
Location: 1650739..1650958 (220 bp)
Type: Others
Protein ID: Protein_1568
Type: Others
Protein ID: Protein_1568
Location: 1651045..1651260 (216 bp)
Type: Others
Protein ID: Protein_1569
Type: Others
Protein ID: Protein_1569
Location: 1654161..1654346 (186 bp)
Type: Toxin
Protein ID: WP_080616079.1
Type: Toxin
Protein ID: WP_080616079.1
Location: 1654363..1654755 (393 bp)
Type: Antitoxin
Protein ID: WP_080616080.1
Type: Antitoxin
Protein ID: WP_080616080.1
Location: 1655624..1655818 (195 bp)
Type: Others
Protein ID: WP_080616082.1
Type: Others
Protein ID: WP_080616082.1
Location: 1655959..1656210 (252 bp)
Type: Others
Protein ID: WP_080616083.1
Type: Others
Protein ID: WP_080616083.1
Location: 1656211..1657521 (1311 bp)
Type: Others
Protein ID: WP_080616084.1
Type: Others
Protein ID: WP_080616084.1
Location: 1657925..1658176 (252 bp)
Type: Others
Protein ID: Protein_1583
Type: Others
Protein ID: Protein_1583
Location: 1651594..1651923 (330 bp)
Type: Others
Protein ID: WP_080616073.1
Type: Others
Protein ID: WP_080616073.1
Location: 1651932..1652429 (498 bp)
Type: Others
Protein ID: WP_080616074.1
Type: Others
Protein ID: WP_080616074.1
Location: 1652434..1652646 (213 bp)
Type: Others
Protein ID: WP_080616075.1
Type: Others
Protein ID: WP_080616075.1
Location: 1652746..1653057 (312 bp)
Type: Others
Protein ID: WP_080616076.1
Type: Others
Protein ID: WP_080616076.1
Location: 1653062..1653520 (459 bp)
Type: Others
Protein ID: WP_080616077.1
Type: Others
Protein ID: WP_080616077.1
Location: 1653520..1653972 (453 bp)
Type: Others
Protein ID: WP_080616078.1
Type: Others
Protein ID: WP_080616078.1
Location: 1654764..1655360 (597 bp)
Type: Others
Protein ID: WP_080616081.1
Type: Others
Protein ID: WP_080616081.1
Location: 1657683..1657925 (243 bp)
Type: Others
Protein ID: Protein_1582
Type: Others
Protein ID: Protein_1582
Location: 1658180..1658458 (279 bp)
Type: Others
Protein ID: WP_080616085.1
Type: Others
Protein ID: WP_080616085.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B5V46_RS07790 | 1649524..1650408 | + | 885 | WP_080617988.1 | follicular epithelium yolk protein subunit | - |
B5V46_RS19710 | 1650739..1650958 | + | 220 | Protein_1568 | transposase | - |
B5V46_RS07800 | 1651045..1651260 | + | 216 | Protein_1569 | IS110 family transposase | - |
B5V46_RS07805 | 1651594..1651923 | - | 330 | WP_080616073.1 | bacteriophage spanin2 family protein | - |
B5V46_RS07810 | 1651932..1652429 | - | 498 | WP_080616074.1 | lysozyme | - |
B5V46_RS07815 | 1652434..1652646 | - | 213 | WP_080616075.1 | hypothetical protein | - |
B5V46_RS07820 | 1652746..1653057 | - | 312 | WP_080616076.1 | hypothetical protein | - |
B5V46_RS07825 | 1653062..1653520 | - | 459 | WP_080616077.1 | hypothetical protein | - |
B5V46_RS07830 | 1653520..1653972 | - | 453 | WP_080616078.1 | hypothetical protein | - |
B5V46_RS07835 | 1654161..1654346 | + | 186 | WP_080616079.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
B5V46_RS07840 | 1654363..1654755 | + | 393 | WP_080616080.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
B5V46_RS07845 | 1654764..1655360 | - | 597 | WP_080616081.1 | hypothetical protein | - |
B5V46_RS07850 | 1655624..1655818 | + | 195 | WP_080616082.1 | hypothetical protein | - |
B5V46_RS07855 | 1655959..1656210 | + | 252 | WP_080616083.1 | helix-turn-helix transcriptional regulator | - |
B5V46_RS07860 | 1656211..1657521 | + | 1311 | WP_080616084.1 | type II toxin-antitoxin system HipA family toxin | - |
B5V46_RS20205 | 1657683..1657925 | - | 243 | Protein_1582 | hypothetical protein | - |
B5V46_RS20210 | 1657925..1658176 | + | 252 | Protein_1583 | zinc ribbon domain-containing protein | - |
B5V46_RS20215 | 1658180..1658458 | - | 279 | WP_080616085.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1639656..1665956 | 26300 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7041.28 Da Isoelectric Point: 11.0108
>T74555 WP_080616079.1 NZ_CP020384:1654161-1654346 [Rhodovulum sp. MB263]
MLETNSRKIVKRLEQDGFELVKVTGSHPKFRKGDRIVTIPHPKKDLPIGTVRNIYKQAGWL
MLETNSRKIVKRLEQDGFELVKVTGSHPKFRKGDRIVTIPHPKKDLPIGTVRNIYKQAGWL
Download Length: 186 bp
>T74555 NZ_CP020384:1654161-1654346 [Rhodovulum sp. MB263]
ATGCTCGAGACCAACAGCCGCAAGATCGTCAAGCGTCTCGAGCAAGACGGCTTCGAGCTGGTGAAGGTCACCGGGTCGCA
CCCCAAGTTTCGCAAGGGCGACAGGATCGTGACGATCCCCCACCCGAAGAAGGACCTGCCCATCGGCACGGTCCGCAACA
TCTACAAACAGGCCGGCTGGCTGTAA
ATGCTCGAGACCAACAGCCGCAAGATCGTCAAGCGTCTCGAGCAAGACGGCTTCGAGCTGGTGAAGGTCACCGGGTCGCA
CCCCAAGTTTCGCAAGGGCGACAGGATCGTGACGATCCCCCACCCGAAGAAGGACCTGCCCATCGGCACGGTCCGCAACA
TCTACAAACAGGCCGGCTGGCTGTAA
Antitoxin
Download Length: 131 a.a. Molecular weight: 13891.67 Da Isoelectric Point: 4.4859
>AT74555 WP_080616080.1 NZ_CP020384:1654363-1654755 [Rhodovulum sp. MB263]
MRHYIGVVHQEDDSAFGIHFPDVPGCFSAADALDDLLSNASEALALHLEDEVLPEARSLDAVRADSDVARDLEAGAFLLA
VPFFRLSGRTAKANITMDAGLLAAIDQTAKARGLTRSAFLADLARREIIG
MRHYIGVVHQEDDSAFGIHFPDVPGCFSAADALDDLLSNASEALALHLEDEVLPEARSLDAVRADSDVARDLEAGAFLLA
VPFFRLSGRTAKANITMDAGLLAAIDQTAKARGLTRSAFLADLARREIIG
Download Length: 393 bp
>AT74555 NZ_CP020384:1654363-1654755 [Rhodovulum sp. MB263]
ATGCGTCACTACATCGGCGTCGTGCACCAGGAAGACGACAGCGCCTTCGGCATCCATTTCCCCGACGTGCCCGGCTGCTT
CTCGGCCGCCGATGCGCTCGACGATCTTCTGTCCAATGCCAGCGAGGCGCTCGCGCTTCATCTCGAGGACGAGGTCCTGC
CCGAGGCGCGCAGCCTCGATGCCGTTCGCGCCGACAGCGACGTGGCCCGCGACCTCGAGGCGGGGGCCTTCCTTCTGGCG
GTGCCGTTCTTCCGCCTGAGCGGGCGGACCGCCAAGGCGAATATCACCATGGATGCGGGGCTGCTGGCAGCCATCGACCA
GACGGCGAAGGCGCGCGGGCTGACCCGCTCGGCCTTCCTGGCCGATCTGGCGCGGCGCGAGATCATCGGCTGA
ATGCGTCACTACATCGGCGTCGTGCACCAGGAAGACGACAGCGCCTTCGGCATCCATTTCCCCGACGTGCCCGGCTGCTT
CTCGGCCGCCGATGCGCTCGACGATCTTCTGTCCAATGCCAGCGAGGCGCTCGCGCTTCATCTCGAGGACGAGGTCCTGC
CCGAGGCGCGCAGCCTCGATGCCGTTCGCGCCGACAGCGACGTGGCCCGCGACCTCGAGGCGGGGGCCTTCCTTCTGGCG
GTGCCGTTCTTCCGCCTGAGCGGGCGGACCGCCAAGGCGAATATCACCATGGATGCGGGGCTGCTGGCAGCCATCGACCA
GACGGCGAAGGCGCGCGGGCTGACCCGCTCGGCCTTCCTGGCCGATCTGGCGCGGCGCGAGATCATCGGCTGA