Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 29019..29608 | Replicon | plasmid pVbh_BscR1 |
Accession | NZ_CP019790 | ||
Organism | Bartonella schoenbuchensis R1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | BscR1v2_RS07770 | Protein ID | WP_078690368.1 |
Coordinates | 29276..29608 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | N6UD03 |
Locus tag | BscR1v2_RS07765 | Protein ID | WP_010703162.1 |
Coordinates | 29019..29276 (+) | Length | 86 a.a. |
Genomic Context
Location: 25053..25271 (219 bp)
Type: Others
Protein ID: WP_141638309.1
Type: Others
Protein ID: WP_141638309.1
Location: 27960..28348 (389 bp)
Type: Others
Protein ID: Protein_48
Type: Others
Protein ID: Protein_48
Location: 28419..28946 (528 bp)
Type: Others
Protein ID: WP_078690367.1
Type: Others
Protein ID: WP_078690367.1
Location: 29019..29276 (258 bp)
Type: Antitoxin
Protein ID: WP_010703162.1
Type: Antitoxin
Protein ID: WP_010703162.1
Location: 29276..29608 (333 bp)
Type: Toxin
Protein ID: WP_078690368.1
Type: Toxin
Protein ID: WP_078690368.1
Location: 29911..30156 (246 bp)
Type: Others
Protein ID: WP_078690369.1
Type: Others
Protein ID: WP_078690369.1
Location: 32978..33259 (282 bp)
Type: Others
Protein ID: WP_078690372.1
Type: Others
Protein ID: WP_078690372.1
Location: 33277..33576 (300 bp)
Type: Others
Protein ID: WP_078690373.1
Type: Others
Protein ID: WP_078690373.1
Location: 24169..24441 (273 bp)
Type: Others
Protein ID: WP_078690365.1
Type: Others
Protein ID: WP_078690365.1
Location: 24521..24691 (171 bp)
Type: Others
Protein ID: WP_194284961.1
Type: Others
Protein ID: WP_194284961.1
Location: 24898..25053 (156 bp)
Type: Others
Protein ID: WP_010703154.1
Type: Others
Protein ID: WP_010703154.1
Location: 25316..25744 (429 bp)
Type: Others
Protein ID: WP_010703155.1
Type: Others
Protein ID: WP_010703155.1
Location: 25808..25999 (192 bp)
Type: Others
Protein ID: WP_010703156.1
Type: Others
Protein ID: WP_010703156.1
Location: 26141..26434 (294 bp)
Type: Others
Protein ID: WP_010703157.1
Type: Others
Protein ID: WP_010703157.1
Location: 26451..26732 (282 bp)
Type: Others
Protein ID: WP_078690366.1
Type: Others
Protein ID: WP_078690366.1
Location: 27005..27316 (312 bp)
Type: Others
Protein ID: WP_010703159.1
Type: Others
Protein ID: WP_010703159.1
Location: 27329..27652 (324 bp)
Type: Others
Protein ID: Protein_47
Type: Others
Protein ID: Protein_47
Location: 29669..29899 (231 bp)
Type: Others
Protein ID: WP_078690392.1
Type: Others
Protein ID: WP_078690392.1
Location: 30267..30602 (336 bp)
Type: Others
Protein ID: WP_078690393.1
Type: Others
Protein ID: WP_078690393.1
Location: 30817..31122 (306 bp)
Type: Others
Protein ID: WP_078690370.1
Type: Others
Protein ID: WP_078690370.1
Location: 31251..32510 (1260 bp)
Type: Others
Protein ID: WP_078690371.1
Type: Others
Protein ID: WP_078690371.1
Location: 33671..33873 (203 bp)
Type: Others
Protein ID: Protein_59
Type: Others
Protein ID: Protein_59
Location: 33921..34226 (306 bp)
Type: Others
Protein ID: WP_010703129.1
Type: Others
Protein ID: WP_010703129.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BscR1v2_RS07720 (BscR1v2_016500) | 24169..24441 | - | 273 | WP_078690365.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
BscR1v2_RS08150 (BscR1v2_016510) | 24521..24691 | - | 171 | WP_194284961.1 | hypothetical protein | - |
BscR1v2_RS08100 (BscR1v2_016520) | 24898..25053 | - | 156 | WP_010703154.1 | hypothetical protein | - |
BscR1v2_RS08105 (BscR1v2_016530) | 25053..25271 | + | 219 | WP_141638309.1 | hypothetical protein | - |
BscR1v2_RS07725 (BscR1v2_016540) | 25316..25744 | - | 429 | WP_010703155.1 | type II toxin-antitoxin system HicB family antitoxin | - |
BscR1v2_RS07730 (BscR1v2_016550) | 25808..25999 | - | 192 | WP_010703156.1 | hypothetical protein | - |
BscR1v2_RS07735 (BscR1v2_016560) | 26141..26434 | - | 294 | WP_010703157.1 | HigA family addiction module antidote protein | - |
BscR1v2_RS07740 (BscR1v2_016570) | 26451..26732 | - | 282 | WP_078690366.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BscR1v2_RS07745 (BscR1v2_016580) | 27005..27316 | - | 312 | WP_010703159.1 | transcriptional regulator | - |
BscR1v2_RS07750 | 27329..27652 | - | 324 | Protein_47 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BscR1v2_RS07755 | 27960..28348 | + | 389 | Protein_48 | single-stranded DNA-binding protein | - |
BscR1v2_RS07760 (BscR1v2_016600) | 28419..28946 | + | 528 | WP_078690367.1 | hypothetical protein | - |
BscR1v2_RS07765 (BscR1v2_016610) | 29019..29276 | + | 258 | WP_010703162.1 | PemI protein | Antitoxin |
BscR1v2_RS07770 (BscR1v2_016620) | 29276..29608 | + | 333 | WP_078690368.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BscR1v2_RS07775 (BscR1v2_016630) | 29669..29899 | - | 231 | WP_078690392.1 | hypothetical protein | - |
BscR1v2_RS07780 (BscR1v2_016640) | 29911..30156 | + | 246 | WP_078690369.1 | type II toxin-antitoxin system HicB family antitoxin | - |
BscR1v2_RS07785 | 30267..30602 | - | 336 | WP_078690393.1 | hypothetical protein | - |
BscR1v2_RS07790 (BscR1v2_016660) | 30817..31122 | - | 306 | WP_078690370.1 | hypothetical protein | - |
BscR1v2_RS07795 (BscR1v2_016670) | 31251..32510 | - | 1260 | WP_078690371.1 | hypothetical protein | - |
BscR1v2_RS07800 (BscR1v2_016680) | 32978..33259 | + | 282 | WP_078690372.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BscR1v2_RS07805 (BscR1v2_016690) | 33277..33576 | + | 300 | WP_078690373.1 | HigA family addiction module antidote protein | - |
BscR1v2_RS07810 | 33671..33873 | - | 203 | Protein_59 | tyrosine-type recombinase/integrase | - |
BscR1v2_RS07815 (BscR1v2_016700) | 33921..34226 | - | 306 | WP_010703129.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | virB4 / virB11 | 1..55761 | 55761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11844.98 Da Isoelectric Point: 10.6999
>T73310 WP_078690368.1 NZ_CP019790:29276-29608 [Bartonella schoenbuchensis R1]
MKRGEIWLVSLDPSSGYEQKGTRPVLIVSPEAFNRVTKTPVVLPITSGGSFARTAGFAVSLMGMGLHTTGVIRCDQPRAL
DIGARKGKKLETVPVMIMNEVLAKLSTFLT
MKRGEIWLVSLDPSSGYEQKGTRPVLIVSPEAFNRVTKTPVVLPITSGGSFARTAGFAVSLMGMGLHTTGVIRCDQPRAL
DIGARKGKKLETVPVMIMNEVLAKLSTFLT
Download Length: 333 bp
>T73310 NZ_CP019790:29276-29608 [Bartonella schoenbuchensis R1]
ATGAAGCGGGGAGAAATTTGGTTAGTATCGCTTGATCCAAGTTCAGGATATGAGCAAAAAGGAACGCGTCCCGTGCTTAT
TGTATCACCAGAAGCATTTAATCGTGTGACTAAAACACCGGTTGTTTTACCCATTACAAGTGGGGGAAGTTTTGCAAGAA
CAGCGGGTTTTGCTGTTTCATTGATGGGAATGGGATTGCACACAACAGGTGTGATACGCTGTGATCAACCACGTGCTCTC
GATATAGGAGCGCGCAAAGGAAAAAAACTAGAAACGGTTCCTGTCATGATTATGAACGAAGTATTAGCTAAGTTGTCAAC
ATTCCTTACGTAA
ATGAAGCGGGGAGAAATTTGGTTAGTATCGCTTGATCCAAGTTCAGGATATGAGCAAAAAGGAACGCGTCCCGTGCTTAT
TGTATCACCAGAAGCATTTAATCGTGTGACTAAAACACCGGTTGTTTTACCCATTACAAGTGGGGGAAGTTTTGCAAGAA
CAGCGGGTTTTGCTGTTTCATTGATGGGAATGGGATTGCACACAACAGGTGTGATACGCTGTGATCAACCACGTGCTCTC
GATATAGGAGCGCGCAAAGGAAAAAAACTAGAAACGGTTCCTGTCATGATTATGAACGAAGTATTAGCTAAGTTGTCAAC
ATTCCTTACGTAA
Antitoxin
Download Length: 86 a.a. Molecular weight: 9370.81 Da Isoelectric Point: 4.0330
>AT73310 WP_010703162.1 NZ_CP019790:29019-29276 [Bartonella schoenbuchensis R1]
MHTTKLRKVGGSVMLSIPPALLDVLHLVENTEVGLTIDNGCLIVQPQIFPSYTLDELLAQCDPLADLSDEETEWLDAKPV
SRELL
MHTTKLRKVGGSVMLSIPPALLDVLHLVENTEVGLTIDNGCLIVQPQIFPSYTLDELLAQCDPLADLSDEETEWLDAKPV
SRELL
Download Length: 258 bp
>AT73310 NZ_CP019790:29019-29276 [Bartonella schoenbuchensis R1]
ATGCACACAACGAAATTGCGTAAAGTTGGAGGGTCAGTTATGCTTTCTATACCACCTGCATTACTTGATGTTTTACACCT
CGTTGAAAATACTGAGGTTGGTTTGACTATTGATAATGGGTGTTTAATTGTACAACCTCAGATATTTCCTAGTTATACTC
TTGACGAATTGTTAGCTCAATGTGATCCTTTGGCTGATCTGAGTGATGAGGAAACAGAATGGCTTGATGCTAAACCTGTT
AGTAGAGAGCTCTTGTAA
ATGCACACAACGAAATTGCGTAAAGTTGGAGGGTCAGTTATGCTTTCTATACCACCTGCATTACTTGATGTTTTACACCT
CGTTGAAAATACTGAGGTTGGTTTGACTATTGATAATGGGTGTTTAATTGTACAACCTCAGATATTTCCTAGTTATACTC
TTGACGAATTGTTAGCTCAATGTGATCCTTTGGCTGATCTGAGTGATGAGGAAACAGAATGGCTTGATGCTAAACCTGTT
AGTAGAGAGCTCTTGTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | N6UD03 |