Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 23514..24079 | Replicon | plasmid unnamed1 |
Accession | NZ_CP019718 | ||
Organism | Paenibacillus larvae subsp. larvae strain Eric_V |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | ERICV_RS24350 | Protein ID | WP_172423969.1 |
Coordinates | 23514..23843 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | ERICV_RS24355 | Protein ID | WP_172424007.1 |
Coordinates | 23840..24079 (-) | Length | 80 a.a. |
Genomic Context
Location: 19434..19676 (243 bp)
Type: Others
Protein ID: WP_172423962.1
Type: Others
Protein ID: WP_172423962.1
Location: 19694..20371 (678 bp)
Type: Others
Protein ID: WP_172423963.1
Type: Others
Protein ID: WP_172423963.1
Location: 20378..20842 (465 bp)
Type: Others
Protein ID: WP_024094413.1
Type: Others
Protein ID: WP_024094413.1
Location: 20860..21135 (276 bp)
Type: Others
Protein ID: WP_036658889.1
Type: Others
Protein ID: WP_036658889.1
Location: 21148..21387 (240 bp)
Type: Others
Protein ID: WP_172423964.1
Type: Others
Protein ID: WP_172423964.1
Location: 21475..21744 (270 bp)
Type: Others
Protein ID: WP_172423965.1
Type: Others
Protein ID: WP_172423965.1
Location: 21784..22026 (243 bp)
Type: Others
Protein ID: WP_172423966.1
Type: Others
Protein ID: WP_172423966.1
Location: 22019..23002 (984 bp)
Type: Others
Protein ID: WP_172423967.1
Type: Others
Protein ID: WP_172423967.1
Location: 23197..23487 (291 bp)
Type: Others
Protein ID: WP_172423968.1
Type: Others
Protein ID: WP_172423968.1
Location: 23514..23843 (330 bp)
Type: Toxin
Protein ID: WP_172423969.1
Type: Toxin
Protein ID: WP_172423969.1
Location: 23840..24079 (240 bp)
Type: Antitoxin
Protein ID: WP_172424007.1
Type: Antitoxin
Protein ID: WP_172424007.1
Location: 24651..25025 (375 bp)
Type: Others
Protein ID: WP_172423970.1
Type: Others
Protein ID: WP_172423970.1
Location: 25009..25197 (189 bp)
Type: Others
Protein ID: WP_172423971.1
Type: Others
Protein ID: WP_172423971.1
Location: 25384..25641 (258 bp)
Type: Others
Protein ID: WP_172423972.1
Type: Others
Protein ID: WP_172423972.1
Location: 25643..26026 (384 bp)
Type: Others
Protein ID: WP_172423973.1
Type: Others
Protein ID: WP_172423973.1
Location: 26033..26323 (291 bp)
Type: Others
Protein ID: WP_172423974.1
Type: Others
Protein ID: WP_172423974.1
Location: 26316..26639 (324 bp)
Type: Others
Protein ID: WP_172423975.1
Type: Others
Protein ID: WP_172423975.1
Location: 26672..26878 (207 bp)
Type: Others
Protein ID: WP_172423976.1
Type: Others
Protein ID: WP_172423976.1
Location: 26887..27585 (699 bp)
Type: Others
Protein ID: WP_172423977.1
Type: Others
Protein ID: WP_172423977.1
Location: 27592..27819 (228 bp)
Type: Others
Protein ID: WP_172423978.1
Type: Others
Protein ID: WP_172423978.1
Location: 28100..28300 (201 bp)
Type: Others
Protein ID: WP_172423979.1
Type: Others
Protein ID: WP_172423979.1
Location: 28303..28503 (201 bp)
Type: Others
Protein ID: WP_172423980.1
Type: Others
Protein ID: WP_172423980.1
Location: 28496..28999 (504 bp)
Type: Others
Protein ID: WP_172423981.1
Type: Others
Protein ID: WP_172423981.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ERICV_RS24305 | 19434..19676 | + | 243 | WP_172423962.1 | hypothetical protein | - |
ERICV_RS24310 | 19694..20371 | + | 678 | WP_172423963.1 | N-acetylmuramoyl-L-alanine amidase | - |
ERICV_RS24315 | 20378..20842 | + | 465 | WP_024094413.1 | hypothetical protein | - |
ERICV_RS24320 | 20860..21135 | + | 276 | WP_036658889.1 | hypothetical protein | - |
ERICV_RS24325 | 21148..21387 | + | 240 | WP_172423964.1 | transposase | - |
ERICV_RS24330 | 21475..21744 | - | 270 | WP_172423965.1 | hypothetical protein | - |
ERICV_RS24335 | 21784..22026 | - | 243 | WP_172423966.1 | hypothetical protein | - |
ERICV_RS24340 | 22019..23002 | - | 984 | WP_172423967.1 | ParM/StbA family protein | - |
ERICV_RS24345 | 23197..23487 | - | 291 | WP_172423968.1 | hypothetical protein | - |
ERICV_RS24350 | 23514..23843 | - | 330 | WP_172423969.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ERICV_RS24355 | 23840..24079 | - | 240 | WP_172424007.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
ERICV_RS24360 | 24651..25025 | - | 375 | WP_172423970.1 | hypothetical protein | - |
ERICV_RS24365 | 25009..25197 | - | 189 | WP_172423971.1 | hypothetical protein | - |
ERICV_RS24370 | 25384..25641 | - | 258 | WP_172423972.1 | hypothetical protein | - |
ERICV_RS24375 | 25643..26026 | - | 384 | WP_172423973.1 | hypothetical protein | - |
ERICV_RS24380 | 26033..26323 | - | 291 | WP_172423974.1 | hypothetical protein | - |
ERICV_RS24385 | 26316..26639 | - | 324 | WP_172423975.1 | hypothetical protein | - |
ERICV_RS24390 | 26672..26878 | - | 207 | WP_172423976.1 | hypothetical protein | - |
ERICV_RS24395 | 26887..27585 | - | 699 | WP_172423977.1 | DNA cytosine methyltransferase | - |
ERICV_RS24400 | 27592..27819 | - | 228 | WP_172423978.1 | hypothetical protein | - |
ERICV_RS24405 | 28100..28300 | - | 201 | WP_172423979.1 | hypothetical protein | - |
ERICV_RS24410 | 28303..28503 | - | 201 | WP_172423980.1 | hypothetical protein | - |
ERICV_RS24415 | 28496..28999 | - | 504 | WP_172423981.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..46114 | 46114 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12491.51 Da Isoelectric Point: 8.0834
>T73217 WP_172423969.1 NZ_CP019718:c23843-23514 [Paenibacillus larvae subsp. larvae]
VTVIPDRGDIVYMDFNPQSGHEQAGWRPALVLSPKLFNATTNLAVVCPITSRVKNYLFEVHLPDTMKTKGVILVHQLKSA
DWRSRKLEIRERAPQEIIDEVIEKIHTFL
VTVIPDRGDIVYMDFNPQSGHEQAGWRPALVLSPKLFNATTNLAVVCPITSRVKNYLFEVHLPDTMKTKGVILVHQLKSA
DWRSRKLEIRERAPQEIIDEVIEKIHTFL
Download Length: 330 bp
>T73217 NZ_CP019718:c23843-23514 [Paenibacillus larvae subsp. larvae]
GTGACAGTTATCCCAGATCGCGGTGATATTGTTTATATGGACTTTAATCCGCAAAGCGGGCATGAACAAGCTGGATGGCG
ACCAGCTCTTGTGTTATCGCCCAAATTATTTAATGCGACAACGAATCTTGCTGTAGTCTGCCCCATCACTTCACGGGTGA
AAAACTACTTATTTGAAGTTCATCTTCCAGACACTATGAAGACAAAAGGTGTTATACTTGTACACCAATTGAAAAGCGCC
GATTGGAGATCGCGGAAATTAGAAATTCGGGAGAGAGCACCACAAGAAATTATTGACGAAGTTATCGAAAAGATTCATAC
TTTCCTATAG
GTGACAGTTATCCCAGATCGCGGTGATATTGTTTATATGGACTTTAATCCGCAAAGCGGGCATGAACAAGCTGGATGGCG
ACCAGCTCTTGTGTTATCGCCCAAATTATTTAATGCGACAACGAATCTTGCTGTAGTCTGCCCCATCACTTCACGGGTGA
AAAACTACTTATTTGAAGTTCATCTTCCAGACACTATGAAGACAAAAGGTGTTATACTTGTACACCAATTGAAAAGCGCC
GATTGGAGATCGCGGAAATTAGAAATTCGGGAGAGAGCACCACAAGAAATTATTGACGAAGTTATCGAAAAGATTCATAC
TTTCCTATAG
Antitoxin
Download Length: 80 a.a. Molecular weight: 8980.29 Da Isoelectric Point: 6.2179
>AT73217 WP_172424007.1 NZ_CP019718:c24079-23840 [Paenibacillus larvae subsp. larvae]
MSTLVSKWGNSLALRIPRHFAESLNLHEGTEVELKLSEDCLSVKPKKKRYTLEELCASIKDGNQHDLIDFGKPVGEEIW
MSTLVSKWGNSLALRIPRHFAESLNLHEGTEVELKLSEDCLSVKPKKKRYTLEELCASIKDGNQHDLIDFGKPVGEEIW
Download Length: 240 bp
>AT73217 NZ_CP019718:c24079-23840 [Paenibacillus larvae subsp. larvae]
ATGAGTACGCTTGTGAGCAAATGGGGAAATAGTCTGGCACTTCGTATTCCCAGACATTTTGCTGAAAGCTTGAATCTTCA
TGAAGGTACTGAAGTTGAATTAAAGCTATCAGAAGACTGCTTGAGTGTCAAGCCAAAGAAAAAAAGGTATACCCTTGAGG
AACTTTGTGCTTCTATTAAAGATGGCAATCAGCATGACCTTATTGACTTCGGTAAACCTGTTGGGGAGGAAATTTGGTGA
ATGAGTACGCTTGTGAGCAAATGGGGAAATAGTCTGGCACTTCGTATTCCCAGACATTTTGCTGAAAGCTTGAATCTTCA
TGAAGGTACTGAAGTTGAATTAAAGCTATCAGAAGACTGCTTGAGTGTCAAGCCAAAGAAAAAAAGGTATACCCTTGAGG
AACTTTGTGCTTCTATTAAAGATGGCAATCAGCATGACCTTATTGACTTCGGTAAACCTGTTGGGGAGGAAATTTGGTGA