Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-UPF0150 |
Location | 582484..583134 | Replicon | chromosome |
Accession | NZ_CP019687 | ||
Organism | Paenibacillus larvae subsp. larvae strain ATCC-9545 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | W2E3Q1 |
Locus tag | BXP28_RS03255 | Protein ID | WP_036658634.1 |
Coordinates | 582931..583134 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | W2E4D8 |
Locus tag | BXP28_RS03250 | Protein ID | WP_023484796.1 |
Coordinates | 582484..582900 (-) | Length | 139 a.a. |
Genomic Context
Location: 577622..578434 (813 bp)
Type: Others
Protein ID: WP_104932619.1
Type: Others
Protein ID: WP_104932619.1
Location: 578553..578771 (219 bp)
Type: Others
Protein ID: WP_036658649.1
Type: Others
Protein ID: WP_036658649.1
Location: 578764..579138 (375 bp)
Type: Others
Protein ID: WP_036658646.1
Type: Others
Protein ID: WP_036658646.1
Location: 579320..579685 (366 bp)
Type: Others
Protein ID: WP_036658643.1
Type: Others
Protein ID: WP_036658643.1
Location: 579702..580484 (783 bp)
Type: Others
Protein ID: WP_023483250.1
Type: Others
Protein ID: WP_023483250.1
Location: 580468..580650 (183 bp)
Type: Others
Protein ID: WP_036658642.1
Type: Others
Protein ID: WP_036658642.1
Location: 580702..580935 (234 bp)
Type: Others
Protein ID: WP_036658640.1
Type: Others
Protein ID: WP_036658640.1
Location: 580928..581173 (246 bp)
Type: Others
Protein ID: WP_036658638.1
Type: Others
Protein ID: WP_036658638.1
Location: 581170..581313 (144 bp)
Type: Others
Protein ID: WP_155116353.1
Type: Others
Protein ID: WP_155116353.1
Location: 581442..581879 (438 bp)
Type: Others
Protein ID: WP_077584885.1
Type: Others
Protein ID: WP_077584885.1
Location: 582085..582429 (345 bp)
Type: Others
Protein ID: WP_036658635.1
Type: Others
Protein ID: WP_036658635.1
Location: 583314..583628 (315 bp)
Type: Others
Protein ID: WP_023484126.1
Type: Others
Protein ID: WP_023484126.1
Location: 583615..583959 (345 bp)
Type: Others
Protein ID: WP_077584886.1
Type: Others
Protein ID: WP_077584886.1
Location: 584063..584377 (315 bp)
Type: Others
Protein ID: WP_023484127.1
Type: Others
Protein ID: WP_023484127.1
Location: 584358..586082 (1725 bp)
Type: Others
Protein ID: WP_077584887.1
Type: Others
Protein ID: WP_077584887.1
Location: 586097..587332 (1236 bp)
Type: Others
Protein ID: WP_036656297.1
Type: Others
Protein ID: WP_036656297.1
Location: 587322..588038 (717 bp)
Type: Others
Protein ID: WP_046655269.1
Type: Others
Protein ID: WP_046655269.1
Location: 582484..582900 (417 bp)
Type: Antitoxin
Protein ID: WP_023484796.1
Type: Antitoxin
Protein ID: WP_023484796.1
Location: 582931..583134 (204 bp)
Type: Toxin
Protein ID: WP_036658634.1
Type: Toxin
Protein ID: WP_036658634.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BXP28_RS03200 | 577622..578434 | + | 813 | WP_104932619.1 | ATP-binding protein | - |
BXP28_RS03205 | 578553..578771 | + | 219 | WP_036658649.1 | hypothetical protein | - |
BXP28_RS03210 | 578764..579138 | + | 375 | WP_036658646.1 | RusA family crossover junction endodeoxyribonuclease | - |
BXP28_RS03215 | 579320..579685 | + | 366 | WP_036658643.1 | hypothetical protein | - |
BXP28_RS03220 | 579702..580484 | + | 783 | WP_023483250.1 | DNA cytosine methyltransferase | - |
BXP28_RS03225 | 580468..580650 | + | 183 | WP_036658642.1 | hypothetical protein | - |
BXP28_RS03230 | 580702..580935 | + | 234 | WP_036658640.1 | hypothetical protein | - |
BXP28_RS03235 | 580928..581173 | + | 246 | WP_036658638.1 | hypothetical protein | - |
BXP28_RS22435 | 581170..581313 | + | 144 | WP_155116353.1 | hypothetical protein | - |
BXP28_RS03240 | 581442..581879 | + | 438 | WP_077584885.1 | transcriptional regulator | - |
BXP28_RS03245 | 582085..582429 | + | 345 | WP_036658635.1 | YxeA family protein | - |
BXP28_RS03250 | 582484..582900 | - | 417 | WP_023484796.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BXP28_RS03255 | 582931..583134 | - | 204 | WP_036658634.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BXP28_RS03260 | 583314..583628 | + | 315 | WP_023484126.1 | hypothetical protein | - |
BXP28_RS03265 | 583615..583959 | + | 345 | WP_077584886.1 | HNH endonuclease | - |
BXP28_RS03270 | 584063..584377 | + | 315 | WP_023484127.1 | P27 family phage terminase small subunit | - |
BXP28_RS03275 | 584358..586082 | + | 1725 | WP_077584887.1 | terminase large subunit | - |
BXP28_RS03280 | 586097..587332 | + | 1236 | WP_036656297.1 | phage portal protein | - |
BXP28_RS03285 | 587322..588038 | + | 717 | WP_046655269.1 | Clp protease ClpP | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 567632..608887 | 41255 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 7803.12 Da Isoelectric Point: 10.9763
>T73170 WP_036658634.1 NZ_CP019687:c583134-582931 [Paenibacillus larvae subsp. larvae]
MINLTKAYSSREVIKILREDGWIHKNTEGDHWHFIHPTKKGKVTVPHPKKGLKRRTTKSIFEQAGLI
MINLTKAYSSREVIKILREDGWIHKNTEGDHWHFIHPTKKGKVTVPHPKKGLKRRTTKSIFEQAGLI
Download Length: 204 bp
>T73170 NZ_CP019687:c583134-582931 [Paenibacillus larvae subsp. larvae]
ATGATAAACCTCACCAAAGCATACTCATCAAGAGAGGTTATCAAAATCTTAAGAGAGGATGGCTGGATACATAAAAACAC
CGAAGGCGATCATTGGCACTTCATACACCCTACTAAAAAAGGAAAGGTGACTGTACCCCATCCGAAAAAAGGCTTGAAAC
GCCGAACAACAAAAAGTATCTTTGAGCAGGCAGGGCTTATATAA
ATGATAAACCTCACCAAAGCATACTCATCAAGAGAGGTTATCAAAATCTTAAGAGAGGATGGCTGGATACATAAAAACAC
CGAAGGCGATCATTGGCACTTCATACACCCTACTAAAAAAGGAAAGGTGACTGTACCCCATCCGAAAAAAGGCTTGAAAC
GCCGAACAACAAAAAGTATCTTTGAGCAGGCAGGGCTTATATAA
Antitoxin
Download Length: 139 a.a. Molecular weight: 15378.23 Da Isoelectric Point: 4.1262
>AT73170 WP_023484796.1 NZ_CP019687:c582900-582484 [Paenibacillus larvae subsp. larvae]
MKYIYPAVFSPGEPDEGGFTVTFPDLPGCISEGDDLEEALRMAKDALGGHLYLMEEDGDEIPRPSQPDSIQLETGEFVSL
IQANTNFVRERIRNKAVNKTLTIPKWLNDAATEEGINFSQTLQDALKQKLDIKVNDFS
MKYIYPAVFSPGEPDEGGFTVTFPDLPGCISEGDDLEEALRMAKDALGGHLYLMEEDGDEIPRPSQPDSIQLETGEFVSL
IQANTNFVRERIRNKAVNKTLTIPKWLNDAATEEGINFSQTLQDALKQKLDIKVNDFS
Download Length: 417 bp
>AT73170 NZ_CP019687:c582900-582484 [Paenibacillus larvae subsp. larvae]
ATGAAGTACATTTACCCTGCTGTTTTTAGTCCTGGCGAACCAGACGAAGGAGGCTTTACTGTCACATTCCCTGACTTGCC
AGGCTGCATATCTGAAGGCGATGATCTGGAAGAAGCCCTGCGCATGGCAAAGGACGCTTTAGGCGGCCACCTCTATCTGA
TGGAAGAGGACGGCGACGAAATACCGCGGCCGTCACAACCAGACTCTATACAGCTTGAAACTGGAGAATTCGTTTCTCTA
ATTCAGGCTAATACCAACTTTGTCCGGGAGCGGATTAGAAACAAGGCTGTGAACAAAACGCTTACCATCCCAAAATGGCT
TAATGATGCAGCAACTGAGGAAGGAATAAACTTTTCTCAGACGCTCCAGGATGCACTAAAACAAAAACTTGATATCAAAG
TAAATGACTTCTCCTGA
ATGAAGTACATTTACCCTGCTGTTTTTAGTCCTGGCGAACCAGACGAAGGAGGCTTTACTGTCACATTCCCTGACTTGCC
AGGCTGCATATCTGAAGGCGATGATCTGGAAGAAGCCCTGCGCATGGCAAAGGACGCTTTAGGCGGCCACCTCTATCTGA
TGGAAGAGGACGGCGACGAAATACCGCGGCCGTCACAACCAGACTCTATACAGCTTGAAACTGGAGAATTCGTTTCTCTA
ATTCAGGCTAATACCAACTTTGTCCGGGAGCGGATTAGAAACAAGGCTGTGAACAAAACGCTTACCATCCCAAAATGGCT
TAATGATGCAGCAACTGAGGAAGGAATAAACTTTTCTCAGACGCTCCAGGATGCACTAAAACAAAAACTTGATATCAAAG
TAAATGACTTCTCCTGA