Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | EcnAB/- |
Location | 3876535..3876896 | Replicon | chromosome |
Accession | NZ_CP018475 | ||
Organism | Xanthomonas perforans strain LH3 |
Toxin (Protein)
Gene name | EcnB | Uniprot ID | M4UGA1 |
Locus tag | BJD13_RS18925 | Protein ID | WP_005914328.1 |
Coordinates | 3876762..3876896 (+) | Length | 45 a.a. |
Antitoxin (Protein)
Gene name | EcnA | Uniprot ID | A0A0G8WVL8 |
Locus tag | BJD13_RS18920 | Protein ID | WP_008576433.1 |
Coordinates | 3876535..3876687 (+) | Length | 51 a.a. |
Genomic Context
Location: 3875505..3876428 (924 bp)
Type: Others
Protein ID: WP_008576436.1
Type: Others
Protein ID: WP_008576436.1
Location: 3876535..3876687 (153 bp)
Type: Antitoxin
Protein ID: WP_008576433.1
Type: Antitoxin
Protein ID: WP_008576433.1
Location: 3876762..3876896 (135 bp)
Type: Toxin
Protein ID: WP_005914328.1
Type: Toxin
Protein ID: WP_005914328.1
Location: 3877124..3877333 (210 bp)
Type: Others
Protein ID: WP_003486601.1
Type: Others
Protein ID: WP_003486601.1
Location: 3877500..3878789 (1290 bp)
Type: Others
Protein ID: WP_008576429.1
Type: Others
Protein ID: WP_008576429.1
Location: 3878840..3879862 (1023 bp)
Type: Others
Protein ID: WP_046932138.1
Type: Others
Protein ID: WP_046932138.1
Location: 3871607..3872287 (681 bp)
Type: Others
Protein ID: WP_008576441.1
Type: Others
Protein ID: WP_008576441.1
Location: 3872756..3873298 (543 bp)
Type: Others
Protein ID: WP_003486615.1
Type: Others
Protein ID: WP_003486615.1
Location: 3873295..3874212 (918 bp)
Type: Others
Protein ID: WP_008576439.1
Type: Others
Protein ID: WP_008576439.1
Location: 3874309..3874668 (360 bp)
Type: Others
Protein ID: WP_003486613.1
Type: Others
Protein ID: WP_003486613.1
Location: 3874732..3875184 (453 bp)
Type: Others
Protein ID: WP_008576438.1
Type: Others
Protein ID: WP_008576438.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BJD13_RS18890 | 3871607..3872287 | - | 681 | WP_008576441.1 | dTMP kinase | - |
BJD13_RS18895 | 3872756..3873298 | - | 543 | WP_003486615.1 | GTPase | - |
BJD13_RS18900 | 3873295..3874212 | - | 918 | WP_008576439.1 | hypothetical protein | - |
BJD13_RS18905 | 3874309..3874668 | - | 360 | WP_003486613.1 | hypothetical protein | - |
BJD13_RS18910 | 3874732..3875184 | - | 453 | WP_008576438.1 | roadblock/LC7 domain-containing protein | - |
BJD13_RS18915 | 3875505..3876428 | + | 924 | WP_008576436.1 | arginase | - |
BJD13_RS18920 | 3876535..3876687 | + | 153 | WP_008576433.1 | entericidin A/B family lipoprotein | Antitoxin |
BJD13_RS18925 | 3876762..3876896 | + | 135 | WP_005914328.1 | entericidin A/B family lipoprotein | Toxin |
BJD13_RS18930 | 3877124..3877333 | + | 210 | WP_003486601.1 | CsbD family protein | - |
BJD13_RS18935 | 3877500..3878789 | + | 1290 | WP_008576429.1 | tryptophan--tRNA ligase | - |
BJD13_RS18940 | 3878840..3879862 | + | 1023 | WP_046932138.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4459.32 Da Isoelectric Point: 9.3487
>T70083 WP_005914328.1 NZ_CP018475:3876762-3876896 [Xanthomonas perforans]
MKRAIVLLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK
MKRAIVLLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK
Download Length: 135 bp
>T70083 NZ_CP018475:3876762-3876896 [Xanthomonas perforans]
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGCGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGCGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
Antitoxin
Download Length: 51 a.a. Molecular weight: 5137.08 Da Isoelectric Point: 8.2782
>AT70083 WP_008576433.1 NZ_CP018475:3876535-3876687 [Xanthomonas perforans]
MKRLLTLMVLALFSAGVMTGCNTVAGAGKDMQGAGDKVEKTAEKCSDGKC
MKRLLTLMVLALFSAGVMTGCNTVAGAGKDMQGAGDKVEKTAEKCSDGKC
Download Length: 153 bp
>AT70083 NZ_CP018475:3876535-3876687 [Xanthomonas perforans]
ATGAAGCGACTGCTGACACTGATGGTGCTGGCCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCCGGCGC
CGGCAAGGACATGCAGGGTGCGGGCGACAAGGTCGAGAAAACGGCCGAAAAATGCAGCGACGGTAAGTGCTGA
ATGAAGCGACTGCTGACACTGATGGTGCTGGCCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCCGGCGC
CGGCAAGGACATGCAGGGTGCGGGCGACAAGGTCGAGAAAACGGCCGAAAAATGCAGCGACGGTAAGTGCTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G2W7U6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0G8WVL8 |