Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3287106..3287512 | Replicon | chromosome |
Accession | NZ_CP017708 | ||
Organism | Moorea producens JHB |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1D9FZA1 |
Locus tag | BJP36_RS12475 | Protein ID | WP_071104008.1 |
Coordinates | 3287106..3287300 (+) | Length | 65 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | F4Y188 |
Locus tag | BJP36_RS12480 | Protein ID | WP_008189734.1 |
Coordinates | 3287297..3287512 (+) | Length | 72 a.a. |
Genomic Context
Location: 3283690..3283884 (195 bp)
Type: Others
Protein ID: Protein_2850
Type: Others
Protein ID: Protein_2850
Location: 3283881..3284183 (303 bp)
Type: Others
Protein ID: WP_071104003.1
Type: Others
Protein ID: WP_071104003.1
Location: 3287106..3287300 (195 bp)
Type: Toxin
Protein ID: WP_071104008.1
Type: Toxin
Protein ID: WP_071104008.1
Location: 3287297..3287512 (216 bp)
Type: Antitoxin
Protein ID: WP_008189734.1
Type: Antitoxin
Protein ID: WP_008189734.1
Location: 3282833..3283040 (208 bp)
Type: Others
Protein ID: Protein_2848
Type: Others
Protein ID: Protein_2848
Location: 3283122..3283397 (276 bp)
Type: Others
Protein ID: WP_202970786.1
Type: Others
Protein ID: WP_202970786.1
Location: 3284362..3285384 (1023 bp)
Type: Others
Protein ID: WP_071104004.1
Type: Others
Protein ID: WP_071104004.1
Location: 3285643..3285801 (159 bp)
Type: Others
Protein ID: WP_071104005.1
Type: Others
Protein ID: WP_071104005.1
Location: 3286037..3286219 (183 bp)
Type: Others
Protein ID: WP_071104006.1
Type: Others
Protein ID: WP_071104006.1
Location: 3286216..3286407 (192 bp)
Type: Others
Protein ID: WP_071104007.1
Type: Others
Protein ID: WP_071104007.1
Location: 3287617..3288477 (861 bp)
Type: Others
Protein ID: WP_071104009.1
Type: Others
Protein ID: WP_071104009.1
Location: 3288539..3288760 (222 bp)
Type: Others
Protein ID: WP_071104010.1
Type: Others
Protein ID: WP_071104010.1
Location: 3288889..3289836 (948 bp)
Type: Others
Protein ID: WP_008189727.1
Type: Others
Protein ID: WP_008189727.1
Location: 3289982..3291640 (1659 bp)
Type: Others
Protein ID: WP_071104011.1
Type: Others
Protein ID: WP_071104011.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BJP36_RS36480 | 3282833..3283040 | - | 208 | Protein_2848 | CopG family transcriptional regulator | - |
BJP36_RS12440 | 3283122..3283397 | - | 276 | WP_202970786.1 | DUF433 domain-containing protein | - |
BJP36_RS12445 | 3283690..3283884 | + | 195 | Protein_2850 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BJP36_RS12450 | 3283881..3284183 | + | 303 | WP_071104003.1 | helix-turn-helix domain-containing protein | - |
BJP36_RS12455 | 3284362..3285384 | - | 1023 | WP_071104004.1 | hypothetical protein | - |
BJP36_RS12460 | 3285643..3285801 | - | 159 | WP_071104005.1 | type II toxin-antitoxin system HicB family antitoxin | - |
BJP36_RS12465 | 3286037..3286219 | - | 183 | WP_071104006.1 | type II toxin-antitoxin system HicA family toxin | - |
BJP36_RS12470 | 3286216..3286407 | - | 192 | WP_071104007.1 | hypothetical protein | - |
BJP36_RS12475 | 3287106..3287300 | + | 195 | WP_071104008.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
BJP36_RS12480 | 3287297..3287512 | + | 216 | WP_008189734.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
BJP36_RS12485 | 3287617..3288477 | - | 861 | WP_071104009.1 | hypothetical protein | - |
BJP36_RS12490 | 3288539..3288760 | - | 222 | WP_071104010.1 | hypothetical protein | - |
BJP36_RS12495 | 3288889..3289836 | - | 948 | WP_008189727.1 | hypothetical protein | - |
BJP36_RS12500 | 3289982..3291640 | - | 1659 | WP_071104011.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7257.63 Da Isoelectric Point: 11.0108
>T68072 WP_071104008.1 NZ_CP017708:3287106-3287300 [Moorena producens JHB]
MKVKEVLKRLKKDGWYQVRMRGSHRILAHPQKPGIVVVPGKLSDEIPIGTLGAIWKQAQLGDER
MKVKEVLKRLKKDGWYQVRMRGSHRILAHPQKPGIVVVPGKLSDEIPIGTLGAIWKQAQLGDER
Download Length: 195 bp
>T68072 NZ_CP017708:3287106-3287300 [Moorena producens JHB]
ATGAAAGTTAAAGAGGTACTTAAGCGATTAAAAAAAGATGGATGGTATCAAGTAAGAATGCGGGGAAGTCATAGAATTTT
AGCTCATCCTCAAAAGCCAGGTATTGTAGTAGTTCCAGGTAAGCTAAGTGATGAGATACCCATCGGAACATTAGGTGCAA
TTTGGAAACAAGCACAGTTAGGAGATGAACGATGA
ATGAAAGTTAAAGAGGTACTTAAGCGATTAAAAAAAGATGGATGGTATCAAGTAAGAATGCGGGGAAGTCATAGAATTTT
AGCTCATCCTCAAAAGCCAGGTATTGTAGTAGTTCCAGGTAAGCTAAGTGATGAGATACCCATCGGAACATTAGGTGCAA
TTTGGAAACAAGCACAGTTAGGAGATGAACGATGA
Antitoxin
Download Length: 72 a.a. Molecular weight: 7776.94 Da Isoelectric Point: 4.0863
>AT68072 WP_008189734.1 NZ_CP017708:3287297-3287512 [Moorena producens JHB]
MKKYAVIYEKGDTNWGAIVPDLPGCVSIGDTLEEVQENVKEAIALYLEVLVEKGEKIPQPQTQVGFVEIAA
MKKYAVIYEKGDTNWGAIVPDLPGCVSIGDTLEEVQENVKEAIALYLEVLVEKGEKIPQPQTQVGFVEIAA
Download Length: 216 bp
>AT68072 NZ_CP017708:3287297-3287512 [Moorena producens JHB]
ATGAAAAAATATGCAGTAATTTATGAAAAAGGCGATACCAACTGGGGGGCAATTGTGCCAGATTTACCCGGTTGTGTTAG
TATTGGTGACACTTTGGAAGAAGTCCAAGAAAATGTTAAAGAGGCGATCGCACTTTATCTGGAAGTTTTGGTCGAAAAAG
GAGAAAAAATCCCTCAACCTCAAACCCAAGTCGGATTTGTAGAAATAGCAGCTTAA
ATGAAAAAATATGCAGTAATTTATGAAAAAGGCGATACCAACTGGGGGGCAATTGTGCCAGATTTACCCGGTTGTGTTAG
TATTGGTGACACTTTGGAAGAAGTCCAAGAAAATGTTAAAGAGGCGATCGCACTTTATCTGGAAGTTTTGGTCGAAAAAG
GAGAAAAAATCCCTCAACCTCAAACCCAAGTCGGATTTGTAGAAATAGCAGCTTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D9FZA1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | F4Y188 |