Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 1818202..1818741 | Replicon | chromosome |
Accession | NZ_CP017491 | ||
Organism | Mannheimia haemolytica strain 38599 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A248ZYA9 |
Locus tag | BG598_RS09365 | Protein ID | WP_006247804.1 |
Coordinates | 1818472..1818741 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A547E920 |
Locus tag | BG598_RS09360 | Protein ID | WP_006247803.1 |
Coordinates | 1818202..1818468 (+) | Length | 89 a.a. |
Genomic Context
Location: 1816055..1816282 (228 bp)
Type: Others
Protein ID: Protein_1811
Type: Others
Protein ID: Protein_1811
Location: 1816307..1816702 (396 bp)
Type: Others
Protein ID: WP_006247799.1
Type: Others
Protein ID: WP_006247799.1
Location: 1816734..1817375 (642 bp)
Type: Others
Protein ID: WP_006247800.1
Type: Others
Protein ID: WP_006247800.1
Location: 1817458..1817859 (402 bp)
Type: Others
Protein ID: WP_006247801.1
Type: Others
Protein ID: WP_006247801.1
Location: 1817904..1818134 (231 bp)
Type: Others
Protein ID: WP_006247802.1
Type: Others
Protein ID: WP_006247802.1
Location: 1818202..1818468 (267 bp)
Type: Antitoxin
Protein ID: WP_006247803.1
Type: Antitoxin
Protein ID: WP_006247803.1
Location: 1818472..1818741 (270 bp)
Type: Toxin
Protein ID: WP_006247804.1
Type: Toxin
Protein ID: WP_006247804.1
Location: 1818816..1819079 (264 bp)
Type: Others
Protein ID: WP_006247805.1
Type: Others
Protein ID: WP_006247805.1
Location: 1819139..1819849 (711 bp)
Type: Others
Protein ID: WP_006253312.1
Type: Others
Protein ID: WP_006253312.1
Location: 1819827..1820117 (291 bp)
Type: Others
Protein ID: Protein_1820
Type: Others
Protein ID: Protein_1820
Location: 1820107..1820826 (720 bp)
Type: Others
Protein ID: WP_006247806.1
Type: Others
Protein ID: WP_006247806.1
Location: 1821048..1821674 (627 bp)
Type: Others
Protein ID: WP_006247807.1
Type: Others
Protein ID: WP_006247807.1
Location: 1821723..1822334 (612 bp)
Type: Others
Protein ID: WP_006253310.1
Type: Others
Protein ID: WP_006253310.1
Location: 1822445..1823131 (687 bp)
Type: Others
Protein ID: WP_006247808.1
Type: Others
Protein ID: WP_006247808.1
Location: 1823141..1823299 (159 bp)
Type: Others
Protein ID: WP_006247809.1
Type: Others
Protein ID: WP_006247809.1
Location: 1813602..1814237 (636 bp)
Type: Others
Protein ID: Protein_1806
Type: Others
Protein ID: Protein_1806
Location: 1814338..1815048 (711 bp)
Type: Others
Protein ID: Protein_1807
Type: Others
Protein ID: Protein_1807
Location: 1814952..1815275 (324 bp)
Type: Others
Protein ID: WP_006253316.1
Type: Others
Protein ID: WP_006253316.1
Location: 1815356..1815523 (168 bp)
Type: Others
Protein ID: WP_006253314.1
Type: Others
Protein ID: WP_006253314.1
Location: 1815531..1815905 (375 bp)
Type: Others
Protein ID: WP_006247798.1
Type: Others
Protein ID: WP_006247798.1
Location: 1823308..1823607 (300 bp)
Type: Others
Protein ID: WP_006247810.1
Type: Others
Protein ID: WP_006247810.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BG598_RS09305 | 1813602..1814237 | - | 636 | Protein_1806 | transposase | - |
BG598_RS09315 | 1814338..1815048 | - | 711 | Protein_1807 | tyrosine-type recombinase/integrase | - |
BG598_RS09320 | 1814952..1815275 | - | 324 | WP_006253316.1 | helix-turn-helix domain-containing protein | - |
BG598_RS09325 | 1815356..1815523 | - | 168 | WP_006253314.1 | DNA cytosine methyltransferase | - |
BG598_RS09330 | 1815531..1815905 | - | 375 | WP_006247798.1 | hypothetical protein | - |
BG598_RS09335 | 1816055..1816282 | + | 228 | Protein_1811 | phage terminase large subunit family protein | - |
BG598_RS09340 | 1816307..1816702 | + | 396 | WP_006247799.1 | phage tail protein | - |
BG598_RS09345 | 1816734..1817375 | + | 642 | WP_006247800.1 | hypothetical protein | - |
BG598_RS09350 | 1817458..1817859 | + | 402 | WP_006247801.1 | hypothetical protein | - |
BG598_RS09355 | 1817904..1818134 | + | 231 | WP_006247802.1 | DUF4035 domain-containing protein | - |
BG598_RS09360 | 1818202..1818468 | + | 267 | WP_006247803.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BG598_RS09365 | 1818472..1818741 | + | 270 | WP_006247804.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
BG598_RS09370 | 1818816..1819079 | + | 264 | WP_006247805.1 | hypothetical protein | - |
BG598_RS09375 | 1819139..1819849 | + | 711 | WP_006253312.1 | tape measure protein | - |
BG598_RS09380 | 1819827..1820117 | + | 291 | Protein_1820 | C40 family peptidase | - |
BG598_RS09385 | 1820107..1820826 | + | 720 | WP_006247806.1 | preprotein translocase subunit YajC | - |
BG598_RS09390 | 1821048..1821674 | + | 627 | WP_006247807.1 | tail assembly protein | - |
BG598_RS09395 | 1821723..1822334 | + | 612 | WP_006253310.1 | hypothetical protein | - |
BG598_RS09400 | 1822445..1823131 | + | 687 | WP_006247808.1 | hypothetical protein | - |
BG598_RS13715 | 1823141..1823299 | + | 159 | WP_006247809.1 | hypothetical protein | - |
BG598_RS09405 | 1823308..1823607 | - | 300 | WP_006247810.1 | XRE family transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1804295..1826082 | 21787 | |
- | flank | IS/Tn | - | - | 1813545..1814237 | 692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10278.90 Da Isoelectric Point: 6.2121
>T66965 WP_006247804.1 NZ_CP017491:1818472-1818741 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG
Download Length: 270 bp
>T66965 NZ_CP017491:1818472-1818741 [Mannheimia haemolytica]
ATGCTACAAATTTCGCCGACAAACGCATATAAAAGAGACTTTAAAAAGATTGCAGCCGAATTAGTCGGTAGTTCGGAATA
TGTGGAAGTAATGTATTGCCTAATAAACCAATTACCATTGGCGGAAAAATATAGAGATCACCCACTACAAGGTGAATGGC
AAGGCTTTAGAGATTGCCATATTAAGCCTGATTTAGTGTTGATTTACGCTGTTGAAGATAATCTGCTCCGCCTTGTTCGT
TTAGGATCGCACGCTGAATTATTTGGATAA
ATGCTACAAATTTCGCCGACAAACGCATATAAAAGAGACTTTAAAAAGATTGCAGCCGAATTAGTCGGTAGTTCGGAATA
TGTGGAAGTAATGTATTGCCTAATAAACCAATTACCATTGGCGGAAAAATATAGAGATCACCCACTACAAGGTGAATGGC
AAGGCTTTAGAGATTGCCATATTAAGCCTGATTTAGTGTTGATTTACGCTGTTGAAGATAATCTGCTCCGCCTTGTTCGT
TTAGGATCGCACGCTGAATTATTTGGATAA
Antitoxin
Download Length: 89 a.a. Molecular weight: 9913.38 Da Isoelectric Point: 7.0082
>AT66965 WP_006247803.1 NZ_CP017491:1818202-1818468 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE
Download Length: 267 bp
>AT66965 NZ_CP017491:1818202-1818468 [Mannheimia haemolytica]
ATGGCGACTATCAATGATGCTTTCAGTTTTAGAACAAATACCGAAATAAAAAATACCGCATTTGATGTAATTAAAAACTA
TGGAATGACACCCTCTCAGGTGTTTAATATGTTTTTAACCGAGATTGCAAAAACGAAAACTATTCCGTTAAGTTTGAATT
ATCAACCCAATCTTGAAACAAAATTGGCAATGCAAGAAGCAAAATCAGGTAAAAATGAAGTTTATGCCTCACTTGAAGCA
TTTCATAAAGCAATGTTAGCGGAGTAA
ATGGCGACTATCAATGATGCTTTCAGTTTTAGAACAAATACCGAAATAAAAAATACCGCATTTGATGTAATTAAAAACTA
TGGAATGACACCCTCTCAGGTGTTTAATATGTTTTTAACCGAGATTGCAAAAACGAAAACTATTCCGTTAAGTTTGAATT
ATCAACCCAATCTTGAAACAAAATTGGCAATGCAAGAAGCAAAATCAGGTAAAAATGAAGTTTATGCCTCACTTGAAGCA
TTTCATAAAGCAATGTTAGCGGAGTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZYA9 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547E920 |