Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 30..106886 | Replicon | plasmid pKpN06-SIL |
| Accession | NZ_CP012994 | ||
| Organism | Klebsiella pneumoniae strain KpN06 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | AQD73_RS27650 | Protein ID | WP_004187044.1 |
| Coordinates | 30..512 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | AQD73_RS27645 | Protein ID | WP_003026799.1 |
| Coordinates | 106886..42 (+) | Length | -35614.333333333 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AQD73_RS27650 | 30..512 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| AQD73_RS27655 | 723..2069 | + | 1347 | WP_077251107.1 | ISNCY family transposase | - |
| AQD73_RS27660 | 2229..2933 | + | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
| AQD73_RS31550 | 3167..3274 | - | 108 | Protein_4 | IS3 family transposase | - |
| AQD73_RS30870 | 3272..3442 | - | 171 | Protein_5 | transposase | - |
| AQD73_RS27670 | 3552..4488 | + | 937 | Protein_6 | ISNCY family transposase | - |
| AQD73_RS27675 | 5536..6813 | - | 1278 | WP_023343081.1 | DUF2254 domain-containing protein | - |
| AQD73_RS27680 | 6876..8873 | - | 1998 | WP_023307506.1 | choline BCCT transporter BetT | - |
| AQD73_RS29800 | 9314..9691 | - | 378 | Protein_9 | LysR family transcriptional regulator | - |
| AQD73_RS27685 | 10480..10833 | + | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| AQD73_RS27690 | 10881..11243 | + | 363 | WP_004118102.1 | arsenite efflux transporter metallochaperone ArsD | - |
| AQD73_RS27695 | 11261..13012 | + | 1752 | WP_060579424.1 | arsenite efflux transporter ATPase subunit ArsA | - |
| AQD73_RS27700 | 13060..14349 | + | 1290 | WP_004118136.1 | arsenite efflux transporter membrane subunit ArsB | - |
| AQD73_RS27705 | 14362..14787 | + | 426 | WP_004118138.1 | glutaredoxin-dependent arsenate reductase | - |
| AQD73_RS27710 | 15138..15751 | + | 614 | Protein_15 | hypothetical protein | - |
| AQD73_RS30875 | 15811..15939 | + | 129 | Protein_16 | transcriptional regulator | - |
| AQD73_RS27715 | 16007..16546 | - | 540 | Protein_17 | DMT family transporter | - |
| AQD73_RS27720 | 16604..17584 | + | 981 | Protein_18 | IS5 family transposase | - |
| AQD73_RS27725 | 17650..19242 | - | 1593 | WP_014839879.1 | IS66-like element ISKox1 family transposase | - |
| AQD73_RS27730 | 19273..19623 | - | 351 | WP_004189161.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| AQD73_RS27735 | 19620..20060 | - | 441 | WP_015632382.1 | IS66 family insertion sequence hypothetical protein | - |
| AQD73_RS27740 | 20415..20849 | - | 435 | WP_004118347.1 | hypothetical protein | - |
| AQD73_RS27745 | 21065..22465 | - | 1401 | WP_002436614.1 | copper resistance membrane spanning protein PcoS | - |
| AQD73_RS27750 | 22462..23142 | - | 681 | WP_001188930.1 | copper response regulator transcription factor PcoR | - |
| AQD73_RS27755 | 23197..24126 | - | 930 | WP_004118344.1 | copper resistance inner membrane protein PcoD | - |
| AQD73_RS27760 | 24131..24511 | - | 381 | WP_000025662.1 | copper resistance system metallochaperone PcoC | - |
| AQD73_RS27765 | 24551..25441 | - | 891 | WP_020803534.1 | copper resistance outer membrane transporter PcoB | - |
| AQD73_RS27770 | 25447..27264 | - | 1818 | WP_000925242.1 | multicopper oxidase PcoA | - |
| AQD73_RS27775 | 27633..28601 | - | 969 | WP_074194210.1 | IS5 family transposase | - |
| AQD73_RS27780 | 28619..28987 | - | 369 | Protein_30 | ATP-binding protein | - |
| AQD73_RS29810 | 29010..29546 | + | 537 | Protein_31 | IS3 family transposase | - |
| AQD73_RS27790 | 29826..30908 | + | 1083 | WP_060579421.1 | IS110 family transposase | - |
| AQD73_RS29820 | 30924..31232 | + | 309 | Protein_33 | DDE-type integrase/transposase/recombinase | - |
| AQD73_RS27805 | 33088..33828 | + | 741 | WP_004187098.1 | site-specific integrase | - |
| AQD73_RS27810 | 34525..35535 | - | 1011 | WP_000200070.1 | RepB family plasmid replication initiator protein | - |
| AQD73_RS27815 | 36276..37442 | + | 1167 | WP_000523812.1 | plasmid-partitioning protein SopA | - |
| AQD73_RS27820 | 37442..38413 | + | 972 | WP_000817038.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| AQD73_RS27825 | 39662..39967 | - | 306 | WP_000534920.1 | hypothetical protein | - |
| AQD73_RS27830 | 40021..40272 | - | 252 | WP_004187100.1 | hypothetical protein | - |
| AQD73_RS27835 | 40351..41622 | - | 1272 | WP_004187101.1 | Y-family DNA polymerase | - |
| AQD73_RS27840 | 41622..41819 | - | 198 | Protein_42 | peptidase | - |
| AQD73_RS29840 | 41884..42588 | + | 705 | Protein_43 | IS6 family transposase | - |
| AQD73_RS30255 | 42617..43437 | - | 821 | Protein_44 | IS5 family transposase | - |
| AQD73_RS27855 | 43482..43790 | + | 309 | Protein_45 | molecular chaperone | - |
| AQD73_RS31555 | 43780..43920 | - | 141 | WP_162833785.1 | hypothetical protein | - |
| AQD73_RS27860 | 44166..45086 | - | 921 | WP_031591935.1 | carbohydrate kinase | - |
| AQD73_RS27865 | 45083..46453 | - | 1371 | WP_031591936.1 | hypothetical protein | - |
| AQD73_RS27870 | 46531..47550 | - | 1020 | WP_031591938.1 | ribose ABC transporter permease | - |
| AQD73_RS27875 | 47537..49069 | - | 1533 | WP_031591939.1 | sugar ABC transporter ATP-binding protein | - |
| AQD73_RS27880 | 49133..50086 | - | 954 | WP_048286516.1 | ABC transporter substrate-binding protein | - |
| AQD73_RS27885 | 50390..51415 | - | 1026 | WP_031592191.1 | LacI family transcriptional regulator | - |
| AQD73_RS27890 | 52214..53218 | - | 1005 | WP_000427619.1 | IS110-like element IS5075 family transposase | - |
| AQD73_RS29850 | 53415..53555 | - | 141 | Protein_54 | NAD(P)H-dependent oxidoreductase | - |
| AQD73_RS27895 | 53818..54171 | + | 354 | WP_031591996.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| AQD73_RS27900 | 54219..54581 | + | 363 | WP_031591995.1 | arsenite efflux transporter metallochaperone ArsD | - |
| AQD73_RS27905 | 54598..56349 | + | 1752 | WP_031591994.1 | arsenical pump-driving ATPase | - |
| AQD73_RS27910 | 56396..57685 | + | 1290 | WP_031591992.1 | arsenic transporter | - |
| AQD73_RS27915 | 57698..58123 | + | 426 | WP_031591991.1 | glutaredoxin-dependent arsenate reductase | - |
| AQD73_RS27920 | 58314..59294 | + | 981 | Protein_60 | IS5 family transposase | - |
| AQD73_RS27925 | 59835..60608 | - | 774 | WP_004729618.1 | SDR family oxidoreductase | - |
| AQD73_RS27930 | 60674..61375 | - | 702 | WP_031591983.1 | DsbA family oxidoreductase | - |
| AQD73_RS27935 | 61441..62547 | - | 1107 | WP_060579419.1 | alkene reductase | - |
| AQD73_RS27940 | 62760..63089 | + | 330 | WP_031591986.1 | thioredoxin family protein | - |
| AQD73_RS27945 | 63119..63457 | - | 339 | WP_000888080.1 | carboxymuconolactone decarboxylase family protein | - |
| AQD73_RS27950 | 63462..64043 | - | 582 | WP_023304048.1 | TetR/AcrR family transcriptional regulator | - |
| AQD73_RS27955 | 64185..64742 | - | 558 | WP_000108589.1 | OsmC family protein | - |
| AQD73_RS27960 | 64927..65511 | - | 585 | WP_008502231.1 | recombinase family protein | - |
| AQD73_RS27965 | 65671..68655 | + | 2985 | WP_032742905.1 | Tn3 family transposase | - |
| AQD73_RS27970 | 68734..69738 | + | 1005 | WP_000427619.1 | IS110-like element IS5075 family transposase | - |
| AQD73_RS27975 | 70016..70885 | - | 870 | Protein_71 | ISNCY family transposase | - |
| AQD73_RS27980 | 70995..71297 | + | 303 | Protein_72 | IS3 family transposase | - |
| AQD73_RS27985 | 72287..72288 | - | 2 | WP_096810283.1 | IS3-like element ISEc52 family transposase | - |
| AQD73_RS27995 | 73878..74693 | + | 816 | WP_004186996.1 | ABC transporter substrate-binding protein | - |
| AQD73_RS28000 | 74718..76226 | + | 1509 | WP_004186997.1 | amino acid ABC transporter permease/ATP-binding protein | - |
| AQD73_RS28005 | 76236..76958 | + | 723 | WP_004186998.1 | GntR family transcriptional regulator | - |
| AQD73_RS28010 | 76958..77794 | + | 837 | WP_004186999.1 | DUF1989 domain-containing protein | - |
| AQD73_RS28015 | 77835..79289 | - | 1455 | WP_100206809.1 | ATP-grasp domain-containing protein | - |
| AQD73_RS28020 | 79339..80036 | + | 698 | Protein_79 | IS1 family transposase | - |
| AQD73_RS28025 | 80069..80719 | - | 651 | WP_004181705.1 | GntR family transcriptional regulator | - |
| AQD73_RS28030 | 81059..82303 | + | 1245 | WP_004181707.1 | divalent metal cation transporter | - |
| AQD73_RS28035 | 82312..83085 | + | 774 | WP_004181708.1 | LamB/YcsF family protein | - |
| AQD73_RS28040 | 83082..83888 | + | 807 | WP_004187003.1 | putative hydro-lyase | - |
| AQD73_RS28045 | 83901..85484 | + | 1584 | WP_004181711.1 | urea amidolyase family protein | - |
| AQD73_RS28050 | 85484..87229 | + | 1746 | WP_004187005.1 | ATP-grasp domain-containing protein | - |
| AQD73_RS28055 | 87542..88122 | - | 581 | Protein_86 | IS1 family transposase | - |
| AQD73_RS28060 | 88068..88688 | - | 621 | Protein_87 | hypothetical protein | - |
| AQD73_RS28065 | 88688..89152 | - | 465 | WP_004187010.1 | hypothetical protein | - |
| AQD73_RS28075 | 90695..91219 | + | 525 | Protein_89 | hypothetical protein | - |
| AQD73_RS31625 | 91236..91719 | + | 484 | Protein_90 | hypothetical protein | - |
| AQD73_RS31630 | 91717..92016 | + | 300 | Protein_91 | conjugal transfer protein TraH | - |
| AQD73_RS28085 | 92098..93453 | + | 1356 | WP_004187017.1 | ISNCY family transposase | - |
| AQD73_RS28090 | 93469..93753 | - | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| AQD73_RS28095 | 93743..93991 | - | 249 | WP_004187025.1 | plasmid stabilization protein | - |
| AQD73_RS30265 | 94281..94705 | - | 425 | Protein_95 | IS1 family transposase | - |
| AQD73_RS30895 | 94893..95009 | - | 117 | Protein_96 | transposase domain-containing protein | - |
| AQD73_RS31560 | 94954..95217 | - | 264 | WP_004187027.1 | transposase | - |
| AQD73_RS31565 | 95232..95495 | + | 264 | WP_004118208.1 | hypothetical protein | - |
| AQD73_RS28110 | 95739..96020 | + | 282 | WP_013307885.1 | helix-turn-helix domain-containing protein | - |
| AQD73_RS28115 | 96055..96624 | + | 570 | WP_004152117.1 | small heat shock protein sHSP20 | - |
| AQD73_RS28120 | 96730..99525 | + | 2796 | WP_004152116.1 | heat shock survival AAA family ATPase ClpK | - |
| AQD73_RS30905 | 99525..99722 | + | 198 | Protein_102 | hypothetical protein | - |
| AQD73_RS28125 | 99960..100709 | + | 750 | WP_004187033.1 | phosphate-starvation-inducible PsiE family protein | - |
| AQD73_RS28130 | 100696..101658 | + | 963 | WP_004152113.1 | M48 family metalloprotease | - |
| AQD73_RS29920 | 101799..101966 | + | 168 | Protein_105 | transposase | - |
| AQD73_RS28140 | 102035..103015 | + | 981 | Protein_106 | IS5 family transposase | - |
| AQD73_RS31570 | 103073..103318 | + | 246 | WP_032238678.1 | hypothetical protein | - |
| AQD73_RS28145 | 103287..105872 | + | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
| AQD73_RS28150 | 106031..106735 | - | 705 | WP_060579418.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..107110 | 107110 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T57651 WP_004187044.1 NZ_CP012994:30-512 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
>T57651 NZ_CP012994:30-512 [Klebsiella pneumoniae]
GTGGGATGTATAACTGCGCCCGAGCCGTTATCCAGCGCCCATCAACTGGCAGAGTTCGTCAGTGGGGAAACGGTACTCGA
TGAATGGTTAAAACAGAGAGGTTTAAAAAATCAAGCTCTTGGCGCTGCACGAACTTTCGTTGTTTGCAAGACGGGTACGA
AGCAAGTAGCTGGTTTTTACTCTTTGGCCACCGGTAGCGTTAACCATACGGAAGCGACAGGCAGTCTTCGGCGTAACATG
CCAGATCCTATACCGGTGATTATACTCGCTCGCCTGGCGGTAGATGTTTCATTGCACGGAAAAGGGGTTGGCGCCGATTT
ACTTCACGATGCGGTTCTACGCTGTTATCGCGTAGCTGAGAATATTGGCGTTCGTGCGATAATGGTTCACGCGCTTACTG
AAGAAGCCAAAGGTTTCTATGCTCACCATGGATTTAAGGCATCGCAAACTTATGAGCGGACTCTGTTCCTTAAACTTCCA
TGA
GTGGGATGTATAACTGCGCCCGAGCCGTTATCCAGCGCCCATCAACTGGCAGAGTTCGTCAGTGGGGAAACGGTACTCGA
TGAATGGTTAAAACAGAGAGGTTTAAAAAATCAAGCTCTTGGCGCTGCACGAACTTTCGTTGTTTGCAAGACGGGTACGA
AGCAAGTAGCTGGTTTTTACTCTTTGGCCACCGGTAGCGTTAACCATACGGAAGCGACAGGCAGTCTTCGGCGTAACATG
CCAGATCCTATACCGGTGATTATACTCGCTCGCCTGGCGGTAGATGTTTCATTGCACGGAAAAGGGGTTGGCGCCGATTT
ACTTCACGATGCGGTTCTACGCTGTTATCGCGTAGCTGAGAATATTGGCGTTCGTGCGATAATGGTTCACGCGCTTACTG
AAGAAGCCAAAGGTTTCTATGCTCACCATGGATTTAAGGCATCGCAAACTTATGAGCGGACTCTGTTCCTTAAACTTCCA
TGA
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|