Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 945850..946426 | Replicon | chromosome |
Accession | NZ_CP012546 | ||
Organism | Campylobacter pinnipediorum subsp. pinnipediorum strain RM17260 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | CPIN17260_RS04865 | Protein ID | WP_078440649.1 |
Coordinates | 945850..946149 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | CPIN17260_RS04870 | Protein ID | WP_078387707.1 |
Coordinates | 946142..946426 (+) | Length | 95 a.a. |
Genomic Context
Location: 940927..941268 (342 bp)
Type: Others
Protein ID: WP_078387698.1
Type: Others
Protein ID: WP_078387698.1
Location: 941274..941576 (303 bp)
Type: Others
Protein ID: WP_099046655.1
Type: Others
Protein ID: WP_099046655.1
Location: 941614..942816 (1203 bp)
Type: Others
Protein ID: WP_078440645.1
Type: Others
Protein ID: WP_078440645.1
Location: 942806..942991 (186 bp)
Type: Others
Protein ID: WP_078387701.1
Type: Others
Protein ID: WP_078387701.1
Location: 942981..943520 (540 bp)
Type: Others
Protein ID: WP_078440646.1
Type: Others
Protein ID: WP_078440646.1
Location: 943527..943751 (225 bp)
Type: Others
Protein ID: WP_078440647.1
Type: Others
Protein ID: WP_078440647.1
Location: 943742..945445 (1704 bp)
Type: Others
Protein ID: WP_078440648.1
Type: Others
Protein ID: WP_078440648.1
Location: 945850..946149 (300 bp)
Type: Toxin
Protein ID: WP_078440649.1
Type: Toxin
Protein ID: WP_078440649.1
Location: 946142..946426 (285 bp)
Type: Antitoxin
Protein ID: WP_078387707.1
Type: Antitoxin
Protein ID: WP_078387707.1
Location: 947354..947620 (267 bp)
Type: Others
Protein ID: WP_078387709.1
Type: Others
Protein ID: WP_078387709.1
Location: 948932..949114 (183 bp)
Type: Others
Protein ID: WP_078387711.1
Type: Others
Protein ID: WP_078387711.1
Location: 945533..945742 (210 bp)
Type: Others
Protein ID: WP_078387705.1
Type: Others
Protein ID: WP_078387705.1
Location: 946429..947355 (927 bp)
Type: Others
Protein ID: WP_078440650.1
Type: Others
Protein ID: WP_078440650.1
Location: 947773..948855 (1083 bp)
Type: Others
Protein ID: WP_078387710.1
Type: Others
Protein ID: WP_078387710.1
Location: 949219..949482 (264 bp)
Type: Others
Protein ID: WP_078415519.1
Type: Others
Protein ID: WP_078415519.1
Location: 949553..950047 (495 bp)
Type: Others
Protein ID: WP_078440651.1
Type: Others
Protein ID: WP_078440651.1
Location: 950052..950300 (249 bp)
Type: Others
Protein ID: WP_078440652.1
Type: Others
Protein ID: WP_078440652.1
Location: 950303..950539 (237 bp)
Type: Others
Protein ID: WP_078440653.1
Type: Others
Protein ID: WP_078440653.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPIN17260_RS04825 | 940927..941268 | + | 342 | WP_078387698.1 | hypothetical protein | - |
CPIN17260_RS04830 | 941274..941576 | + | 303 | WP_099046655.1 | hypothetical protein | - |
CPIN17260_RS04835 | 941614..942816 | + | 1203 | WP_078440645.1 | hypothetical protein | - |
CPIN17260_RS04840 | 942806..942991 | + | 186 | WP_078387701.1 | hypothetical protein | - |
CPIN17260_RS04845 | 942981..943520 | + | 540 | WP_078440646.1 | hypothetical protein | - |
CPIN17260_RS04850 | 943527..943751 | + | 225 | WP_078440647.1 | hypothetical protein | - |
CPIN17260_RS04855 | 943742..945445 | + | 1704 | WP_078440648.1 | AAA family ATPase | - |
CPIN17260_RS04860 | 945533..945742 | - | 210 | WP_078387705.1 | hypothetical protein | - |
CPIN17260_RS04865 | 945850..946149 | + | 300 | WP_078440649.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CPIN17260_RS04870 | 946142..946426 | + | 285 | WP_078387707.1 | putative addiction module antidote protein | Antitoxin |
CPIN17260_RS04875 | 946429..947355 | - | 927 | WP_078440650.1 | hypothetical protein | - |
CPIN17260_RS04880 | 947354..947620 | + | 267 | WP_078387709.1 | hypothetical protein | - |
CPIN17260_RS04885 | 947773..948855 | - | 1083 | WP_078387710.1 | phage tail tape measure protein | - |
CPIN17260_RS04890 | 948932..949114 | + | 183 | WP_078387711.1 | hypothetical protein | - |
CPIN17260_RS04895 | 949219..949482 | - | 264 | WP_078415519.1 | hypothetical protein | - |
CPIN17260_RS04900 | 949553..950047 | - | 495 | WP_078440651.1 | phage major tail tube protein | - |
CPIN17260_RS04905 | 950052..950300 | - | 249 | WP_078440652.1 | hypothetical protein | - |
CPIN17260_RS04910 | 950303..950539 | - | 237 | WP_078440653.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 927458..975759 | 48301 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11415.09 Da Isoelectric Point: 9.6406
>T56618 WP_078440649.1 NZ_CP012546:945850-946149 [Campylobacter pinnipediorum subsp. pinnipediorum]
MYTIKQTDYFSKWLIKLKDIRGKVSILRRIERIKDGNFGDCKSVGNNISELRITTGPGYRVYYTNKNDEIIILLVGGDKS
TQSNDIKKANEILKDLENE
MYTIKQTDYFSKWLIKLKDIRGKVSILRRIERIKDGNFGDCKSVGNNISELRITTGPGYRVYYTNKNDEIIILLVGGDKS
TQSNDIKKANEILKDLENE
Download Length: 300 bp
>T56618 NZ_CP012546:945850-946149 [Campylobacter pinnipediorum subsp. pinnipediorum]
ATGTATACAATAAAACAAACTGATTACTTTTCAAAATGGCTAATAAAGCTTAAAGATATAAGGGGCAAAGTTTCAATTTT
GCGAAGAATTGAAAGAATAAAAGATGGTAACTTTGGAGATTGCAAATCAGTTGGTAACAATATAAGCGAACTAAGAATTA
CAACTGGTCCAGGATATAGAGTTTATTACACAAATAAAAACGATGAGATTATTATTTTATTAGTTGGCGGGGATAAATCA
ACTCAAAGTAATGATATTAAAAAAGCAAATGAAATTTTAAAGGATTTAGAAAATGAGTAA
ATGTATACAATAAAACAAACTGATTACTTTTCAAAATGGCTAATAAAGCTTAAAGATATAAGGGGCAAAGTTTCAATTTT
GCGAAGAATTGAAAGAATAAAAGATGGTAACTTTGGAGATTGCAAATCAGTTGGTAACAATATAAGCGAACTAAGAATTA
CAACTGGTCCAGGATATAGAGTTTATTACACAAATAAAAACGATGAGATTATTATTTTATTAGTTGGCGGGGATAAATCA
ACTCAAAGTAATGATATTAAAAAAGCAAATGAAATTTTAAAGGATTTAGAAAATGAGTAA
Antitoxin
Download Length: 95 a.a. Molecular weight: 10394.93 Da Isoelectric Point: 5.0477
>AT56618 WP_078387707.1 NZ_CP012546:946142-946426 [Campylobacter pinnipediorum subsp. pinnipediorum]
MSKTQITDFDISQYLDNQEVIAEYISQILADGDMDELLDALGNIAKAKGMSQIAKDTGLGRESLYKTFHKGSKPKFDTIM
KLISSFGLKMQVSA
MSKTQITDFDISQYLDNQEVIAEYISQILADGDMDELLDALGNIAKAKGMSQIAKDTGLGRESLYKTFHKGSKPKFDTIM
KLISSFGLKMQVSA
Download Length: 285 bp
>AT56618 NZ_CP012546:946142-946426 [Campylobacter pinnipediorum subsp. pinnipediorum]
ATGAGTAAAACACAAATAACGGATTTTGATATATCTCAGTATTTAGACAATCAAGAAGTCATAGCAGAATATATATCTCA
AATCTTAGCCGATGGTGATATGGATGAGTTACTAGACGCACTTGGCAATATAGCAAAAGCCAAAGGCATGAGCCAAATAG
CAAAAGACACAGGGCTGGGCAGAGAAAGTTTATATAAAACCTTTCACAAAGGAAGTAAACCAAAGTTTGATACTATAATG
AAACTTATATCTTCTTTTGGTTTAAAAATGCAAGTTAGCGCATAA
ATGAGTAAAACACAAATAACGGATTTTGATATATCTCAGTATTTAGACAATCAAGAAGTCATAGCAGAATATATATCTCA
AATCTTAGCCGATGGTGATATGGATGAGTTACTAGACGCACTTGGCAATATAGCAAAAGCCAAAGGCATGAGCCAAATAG
CAAAAGACACAGGGCTGGGCAGAGAAAGTTTATATAAAACCTTTCACAAAGGAAGTAAACCAAAGTTTGATACTATAATG
AAACTTATATCTTCTTTTGGTTTAAAAATGCAAGTTAGCGCATAA