Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 15331..15881 | Replicon | plasmid unnamed |
Accession | NZ_CP011133 | ||
Organism | Citrobacter amalonaticus Y19 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A0F6TZV8 |
Locus tag | F384_RS26230 | Protein ID | WP_046498752.1 |
Coordinates | 15331..15639 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A0F6RIT5 |
Locus tag | F384_RS26235 | Protein ID | WP_046498757.1 |
Coordinates | 15642..15881 (-) | Length | 80 a.a. |
Genomic Context
Location: 10390..10728 (339 bp)
Type: Others
Protein ID: WP_046498719.1
Type: Others
Protein ID: WP_046498719.1
Location: 10953..11264 (312 bp)
Type: Others
Protein ID: WP_046498724.1
Type: Others
Protein ID: WP_046498724.1
Location: 11304..11612 (309 bp)
Type: Others
Protein ID: WP_046498729.1
Type: Others
Protein ID: WP_046498729.1
Location: 11976..12302 (327 bp)
Type: Others
Protein ID: WP_046498732.1
Type: Others
Protein ID: WP_046498732.1
Location: 12387..12785 (399 bp)
Type: Others
Protein ID: WP_046498736.1
Type: Others
Protein ID: WP_046498736.1
Location: 12796..13038 (243 bp)
Type: Others
Protein ID: WP_046499465.1
Type: Others
Protein ID: WP_046499465.1
Location: 13248..13670 (423 bp)
Type: Others
Protein ID: Protein_21
Type: Others
Protein ID: Protein_21
Location: 13753..14370 (618 bp)
Type: Others
Protein ID: WP_046498741.1
Type: Others
Protein ID: WP_046498741.1
Location: 14443..14997 (555 bp)
Type: Others
Protein ID: WP_046498747.1
Type: Others
Protein ID: WP_046498747.1
Location: 15152..15307 (156 bp)
Type: Others
Protein ID: WP_167337386.1
Type: Others
Protein ID: WP_167337386.1
Location: 15331..15639 (309 bp)
Type: Toxin
Protein ID: WP_046498752.1
Type: Toxin
Protein ID: WP_046498752.1
Location: 15642..15881 (240 bp)
Type: Antitoxin
Protein ID: WP_046498757.1
Type: Antitoxin
Protein ID: WP_046498757.1
Location: 16021..16485 (465 bp)
Type: Others
Protein ID: WP_193388325.1
Type: Others
Protein ID: WP_193388325.1
Location: 16482..17153 (672 bp)
Type: Others
Protein ID: WP_046498763.1
Type: Others
Protein ID: WP_046498763.1
Location: 17614..18255 (642 bp)
Type: Others
Protein ID: WP_046498769.1
Type: Others
Protein ID: WP_046498769.1
Location: 18559..19017 (459 bp)
Type: Others
Protein ID: WP_046498772.1
Type: Others
Protein ID: WP_046498772.1
Location: 19290..19985 (696 bp)
Type: Others
Protein ID: WP_046498775.1
Type: Others
Protein ID: WP_046498775.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
F384_RS26185 | 10390..10728 | + | 339 | WP_046498719.1 | hypothetical protein | - |
F384_RS26190 | 10953..11264 | + | 312 | WP_046498724.1 | hypothetical protein | - |
F384_RS26195 | 11304..11612 | + | 309 | WP_046498729.1 | hypothetical protein | - |
F384_RS26200 | 11976..12302 | - | 327 | WP_046498732.1 | hypothetical protein | - |
F384_RS26205 | 12387..12785 | - | 399 | WP_046498736.1 | hypothetical protein | - |
F384_RS26210 | 12796..13038 | - | 243 | WP_046499465.1 | hypothetical protein | - |
F384_RS26215 | 13248..13670 | - | 423 | Protein_21 | hypothetical protein | - |
F384_RS26220 | 13753..14370 | - | 618 | WP_046498741.1 | hypothetical protein | - |
F384_RS26225 | 14443..14997 | - | 555 | WP_046498747.1 | hypothetical protein | - |
F384_RS30200 | 15152..15307 | - | 156 | WP_167337386.1 | hypothetical protein | - |
F384_RS26230 | 15331..15639 | - | 309 | WP_046498752.1 | CcdB family protein | Toxin |
F384_RS26235 | 15642..15881 | - | 240 | WP_046498757.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
F384_RS30245 | 16021..16485 | - | 465 | WP_193388325.1 | hypothetical protein | - |
F384_RS26245 | 16482..17153 | - | 672 | WP_046498763.1 | hypothetical protein | - |
F384_RS26250 | 17614..18255 | - | 642 | WP_046498769.1 | hypothetical protein | - |
F384_RS26255 | 18559..19017 | - | 459 | WP_046498772.1 | hypothetical protein | - |
F384_RS26260 | 19290..19985 | - | 696 | WP_046498775.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..290993 | 290993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11282.11 Da Isoelectric Point: 7.3147
>T53528 WP_046498752.1 NZ_CP011133:c15639-15331 [Citrobacter amalonaticus Y19]
MQYTVYRNTGNSQAYPYLLDIQSDIIGELNTRLVIPLHLLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKGAVDFLLDGF
MQYTVYRNTGNSQAYPYLLDIQSDIIGELNTRLVIPLHLLKKGASAPVARLTPVIQVEGNDVILMTHEMASVRVKQLGQA
VMDASPFRHTIKGAVDFLLDGF
Download Length: 309 bp
>T53528 NZ_CP011133:c15639-15331 [Citrobacter amalonaticus Y19]
ATGCAATACACCGTTTACCGCAATACCGGCAATAGCCAGGCATATCCTTACCTGCTGGATATACAGAGCGACATCATTGG
TGAGTTGAATACCCGTCTGGTGATCCCGCTTCATCTGCTGAAAAAAGGAGCCTCGGCCCCGGTTGCGCGGTTAACTCCGG
TTATTCAGGTGGAAGGGAATGACGTTATCCTGATGACACATGAAATGGCCTCGGTTCGCGTGAAGCAGCTTGGTCAGGCG
GTCATGGATGCATCTCCGTTCCGGCACACTATCAAAGGCGCTGTGGACTTCCTGCTGGATGGTTTCTGA
ATGCAATACACCGTTTACCGCAATACCGGCAATAGCCAGGCATATCCTTACCTGCTGGATATACAGAGCGACATCATTGG
TGAGTTGAATACCCGTCTGGTGATCCCGCTTCATCTGCTGAAAAAAGGAGCCTCGGCCCCGGTTGCGCGGTTAACTCCGG
TTATTCAGGTGGAAGGGAATGACGTTATCCTGATGACACATGAAATGGCCTCGGTTCGCGTGAAGCAGCTTGGTCAGGCG
GTCATGGATGCATCTCCGTTCCGGCACACTATCAAAGGCGCTGTGGACTTCCTGCTGGATGGTTTCTGA
Antitoxin
Download Length: 80 a.a. Molecular weight: 8843.01 Da Isoelectric Point: 8.6598
>AT53528 WP_046498757.1 NZ_CP011133:c15881-15642 [Citrobacter amalonaticus Y19]
MQTTAARQKKTVSVTLEPMLVQQARDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF
MQTTAARQKKTVSVTLEPMLVQQARDAGINLSATLAEALQSKLKASAAEEWKRQNRAGIQELNRITEEHGLLSDEYRTF
Download Length: 240 bp
>AT53528 NZ_CP011133:c15881-15642 [Citrobacter amalonaticus Y19]
ATGCAGACTACAGCTGCTCGCCAGAAAAAAACCGTCAGTGTCACTCTTGAGCCAATGCTTGTACAGCAGGCAAGAGACGC
TGGGATTAACTTGTCCGCCACGCTGGCAGAAGCGCTTCAGAGCAAACTGAAGGCCAGTGCTGCGGAAGAATGGAAACGAC
AGAATCGTGCTGGTATTCAGGAGTTGAACCGCATCACTGAAGAGCATGGGTTACTGTCTGACGAATACAGGACGTTCTGA
ATGCAGACTACAGCTGCTCGCCAGAAAAAAACCGTCAGTGTCACTCTTGAGCCAATGCTTGTACAGCAGGCAAGAGACGC
TGGGATTAACTTGTCCGCCACGCTGGCAGAAGCGCTTCAGAGCAAACTGAAGGCCAGTGCTGCGGAAGAATGGAAACGAC
AGAATCGTGCTGGTATTCAGGAGTTGAACCGCATCACTGAAGAGCATGGGTTACTGTCTGACGAATACAGGACGTTCTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F6TZV8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F6RIT5 |