Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 885827..886366 | Replicon | chromosome |
Accession | NZ_CP011098 | ||
Organism | Mannheimia haemolytica strain 89010807N isolate laboratory frozen stock |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A248ZYA9 |
Locus tag | WC39_RS04470 | Protein ID | WP_006247804.1 |
Coordinates | 885827..886096 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A547E920 |
Locus tag | WC39_RS04475 | Protein ID | WP_006247803.1 |
Coordinates | 886100..886366 (-) | Length | 89 a.a. |
Genomic Context
Location: 880961..881260 (300 bp)
Type: Others
Protein ID: WP_006247810.1
Type: Others
Protein ID: WP_006247810.1
Location: 888663..889037 (375 bp)
Type: Others
Protein ID: WP_006247798.1
Type: Others
Protein ID: WP_006247798.1
Location: 889045..889212 (168 bp)
Type: Others
Protein ID: WP_006253314.1
Type: Others
Protein ID: WP_006253314.1
Location: 889293..889616 (324 bp)
Type: Others
Protein ID: WP_006253316.1
Type: Others
Protein ID: WP_006253316.1
Location: 889520..890230 (711 bp)
Type: Others
Protein ID: Protein_852
Type: Others
Protein ID: Protein_852
Location: 890331..890966 (636 bp)
Type: Others
Protein ID: Protein_853
Type: Others
Protein ID: Protein_853
Location: 881269..881427 (159 bp)
Type: Others
Protein ID: WP_006247809.1
Type: Others
Protein ID: WP_006247809.1
Location: 881437..882123 (687 bp)
Type: Others
Protein ID: WP_006247808.1
Type: Others
Protein ID: WP_006247808.1
Location: 882234..882845 (612 bp)
Type: Others
Protein ID: WP_006253310.1
Type: Others
Protein ID: WP_006253310.1
Location: 882894..883520 (627 bp)
Type: Others
Protein ID: WP_006247807.1
Type: Others
Protein ID: WP_006247807.1
Location: 883742..884461 (720 bp)
Type: Others
Protein ID: WP_006247806.1
Type: Others
Protein ID: WP_006247806.1
Location: 884451..884741 (291 bp)
Type: Others
Protein ID: Protein_839
Type: Others
Protein ID: Protein_839
Location: 884719..885429 (711 bp)
Type: Others
Protein ID: WP_006253312.1
Type: Others
Protein ID: WP_006253312.1
Location: 885489..885752 (264 bp)
Type: Others
Protein ID: WP_006247805.1
Type: Others
Protein ID: WP_006247805.1
Location: 885827..886096 (270 bp)
Type: Toxin
Protein ID: WP_006247804.1
Type: Toxin
Protein ID: WP_006247804.1
Location: 886100..886366 (267 bp)
Type: Antitoxin
Protein ID: WP_006247803.1
Type: Antitoxin
Protein ID: WP_006247803.1
Location: 886434..886664 (231 bp)
Type: Others
Protein ID: WP_006247802.1
Type: Others
Protein ID: WP_006247802.1
Location: 886709..887110 (402 bp)
Type: Others
Protein ID: WP_006247801.1
Type: Others
Protein ID: WP_006247801.1
Location: 887193..887834 (642 bp)
Type: Others
Protein ID: WP_006247800.1
Type: Others
Protein ID: WP_006247800.1
Location: 887866..888261 (396 bp)
Type: Others
Protein ID: WP_006247799.1
Type: Others
Protein ID: WP_006247799.1
Location: 888286..888513 (228 bp)
Type: Others
Protein ID: Protein_848
Type: Others
Protein ID: Protein_848
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
WC39_RS04425 | 880961..881260 | + | 300 | WP_006247810.1 | XRE family transcriptional regulator | - |
WC39_RS14415 | 881269..881427 | - | 159 | WP_006247809.1 | hypothetical protein | - |
WC39_RS04430 | 881437..882123 | - | 687 | WP_006247808.1 | hypothetical protein | - |
WC39_RS04435 | 882234..882845 | - | 612 | WP_006253310.1 | hypothetical protein | - |
WC39_RS04440 | 882894..883520 | - | 627 | WP_006247807.1 | tail assembly protein | - |
WC39_RS04450 | 883742..884461 | - | 720 | WP_006247806.1 | preprotein translocase subunit YajC | - |
WC39_RS04455 | 884451..884741 | - | 291 | Protein_839 | C40 family peptidase | - |
WC39_RS04460 | 884719..885429 | - | 711 | WP_006253312.1 | tape measure protein | - |
WC39_RS04465 | 885489..885752 | - | 264 | WP_006247805.1 | hypothetical protein | - |
WC39_RS04470 | 885827..886096 | - | 270 | WP_006247804.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
WC39_RS04475 | 886100..886366 | - | 267 | WP_006247803.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
WC39_RS04480 | 886434..886664 | - | 231 | WP_006247802.1 | DUF4035 domain-containing protein | - |
WC39_RS04485 | 886709..887110 | - | 402 | WP_006247801.1 | hypothetical protein | - |
WC39_RS04490 | 887193..887834 | - | 642 | WP_006247800.1 | hypothetical protein | - |
WC39_RS04495 | 887866..888261 | - | 396 | WP_006247799.1 | phage tail protein | - |
WC39_RS13855 | 888286..888513 | - | 228 | Protein_848 | phage terminase large subunit family protein | - |
WC39_RS04500 | 888663..889037 | + | 375 | WP_006247798.1 | hypothetical protein | - |
WC39_RS04505 | 889045..889212 | + | 168 | WP_006253314.1 | DNA cytosine methyltransferase | - |
WC39_RS13860 | 889293..889616 | + | 324 | WP_006253316.1 | helix-turn-helix domain-containing protein | - |
WC39_RS04510 | 889520..890230 | + | 711 | Protein_852 | tyrosine-type recombinase/integrase | - |
WC39_RS04515 | 890331..890966 | + | 636 | Protein_853 | transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 874773..898979 | 24206 | |
- | flank | IS/Tn | - | - | 890331..891023 | 692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10278.90 Da Isoelectric Point: 6.2121
>T53329 WP_006247804.1 NZ_CP011098:c886096-885827 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG
Download Length: 270 bp
>T53329 NZ_CP011098:c886096-885827 [Mannheimia haemolytica]
ATGCTACAAATTTCGCCGACAAACGCATATAAAAGAGACTTTAAAAAGATTGCAGCCGAATTAGTCGGTAGTTCGGAATA
TGTGGAAGTAATGTATTGCCTAATAAACCAATTACCATTGGCGGAAAAATATAGAGATCACCCACTACAAGGTGAATGGC
AAGGCTTTAGAGATTGCCATATTAAGCCTGATTTAGTGTTGATTTACGCTGTTGAAGATAATCTGCTCCGCCTTGTTCGT
TTAGGATCGCACGCTGAATTATTTGGATAA
ATGCTACAAATTTCGCCGACAAACGCATATAAAAGAGACTTTAAAAAGATTGCAGCCGAATTAGTCGGTAGTTCGGAATA
TGTGGAAGTAATGTATTGCCTAATAAACCAATTACCATTGGCGGAAAAATATAGAGATCACCCACTACAAGGTGAATGGC
AAGGCTTTAGAGATTGCCATATTAAGCCTGATTTAGTGTTGATTTACGCTGTTGAAGATAATCTGCTCCGCCTTGTTCGT
TTAGGATCGCACGCTGAATTATTTGGATAA
Antitoxin
Download Length: 89 a.a. Molecular weight: 9913.38 Da Isoelectric Point: 7.0082
>AT53329 WP_006247803.1 NZ_CP011098:c886366-886100 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE
Download Length: 267 bp
>AT53329 NZ_CP011098:c886366-886100 [Mannheimia haemolytica]
ATGGCGACTATCAATGATGCTTTCAGTTTTAGAACAAATACCGAAATAAAAAATACCGCATTTGATGTAATTAAAAACTA
TGGAATGACACCCTCTCAGGTGTTTAATATGTTTTTAACCGAGATTGCAAAAACGAAAACTATTCCGTTAAGTTTGAATT
ATCAACCCAATCTTGAAACAAAATTGGCAATGCAAGAAGCAAAATCAGGTAAAAATGAAGTTTATGCCTCACTTGAAGCA
TTTCATAAAGCAATGTTAGCGGAGTAA
ATGGCGACTATCAATGATGCTTTCAGTTTTAGAACAAATACCGAAATAAAAAATACCGCATTTGATGTAATTAAAAACTA
TGGAATGACACCCTCTCAGGTGTTTAATATGTTTTTAACCGAGATTGCAAAAACGAAAACTATTCCGTTAAGTTTGAATT
ATCAACCCAATCTTGAAACAAAATTGGCAATGCAAGAAGCAAAATCAGGTAAAAATGAAGTTTATGCCTCACTTGAAGCA
TTTCATAAAGCAATGTTAGCGGAGTAA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZYA9 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547E920 |