Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | EcnAB/- |
Location | 4649862..4650223 | Replicon | chromosome |
Accession | NZ_CP009010 | ||
Organism | Xanthomonas citri pv. citri strain JX5 |
Toxin (Protein)
Gene name | EcnB | Uniprot ID | M4UGA1 |
Locus tag | AMD20_RS20500 | Protein ID | WP_005914328.1 |
Coordinates | 4649862..4649996 (-) | Length | 45 a.a. |
Antitoxin (Protein)
Gene name | EcnA | Uniprot ID | H8FG64 |
Locus tag | AMD20_RS20505 | Protein ID | WP_003486606.1 |
Coordinates | 4650071..4650223 (-) | Length | 51 a.a. |
Genomic Context
Location: 4651574..4652026 (453 bp)
Type: Others
Protein ID: WP_003486611.1
Type: Others
Protein ID: WP_003486611.1
Location: 4652090..4652449 (360 bp)
Type: Others
Protein ID: WP_003486613.1
Type: Others
Protein ID: WP_003486613.1
Location: 4652546..4653463 (918 bp)
Type: Others
Protein ID: WP_011052673.1
Type: Others
Protein ID: WP_011052673.1
Location: 4653460..4654002 (543 bp)
Type: Others
Protein ID: WP_003486615.1
Type: Others
Protein ID: WP_003486615.1
Location: 4654440..4655123 (684 bp)
Type: Others
Protein ID: WP_011052674.1
Type: Others
Protein ID: WP_011052674.1
Location: 4645000..4646691 (1692 bp)
Type: Others
Protein ID: WP_015471463.1
Type: Others
Protein ID: WP_015471463.1
Location: 4646883..4647917 (1035 bp)
Type: Others
Protein ID: WP_011052671.1
Type: Others
Protein ID: WP_011052671.1
Location: 4647956..4649245 (1290 bp)
Type: Others
Protein ID: WP_015463705.1
Type: Others
Protein ID: WP_015463705.1
Location: 4649426..4649635 (210 bp)
Type: Others
Protein ID: WP_003486601.1
Type: Others
Protein ID: WP_003486601.1
Location: 4649862..4649996 (135 bp)
Type: Toxin
Protein ID: WP_005914328.1
Type: Toxin
Protein ID: WP_005914328.1
Location: 4650071..4650223 (153 bp)
Type: Antitoxin
Protein ID: WP_003486606.1
Type: Antitoxin
Protein ID: WP_003486606.1
Location: 4650330..4651253 (924 bp)
Type: Others
Protein ID: WP_005927745.1
Type: Others
Protein ID: WP_005927745.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AMD20_RS20480 | 4645000..4646691 | - | 1692 | WP_015471463.1 | M20/M25/M40 family metallo-hydrolase | - |
AMD20_RS20485 | 4646883..4647917 | - | 1035 | WP_011052671.1 | MBL fold metallo-hydrolase | - |
AMD20_RS20490 | 4647956..4649245 | - | 1290 | WP_015463705.1 | tryptophan--tRNA ligase | - |
AMD20_RS20495 | 4649426..4649635 | - | 210 | WP_003486601.1 | CsbD family protein | - |
AMD20_RS20500 | 4649862..4649996 | - | 135 | WP_005914328.1 | entericidin A/B family lipoprotein | Toxin |
AMD20_RS20505 | 4650071..4650223 | - | 153 | WP_003486606.1 | entericidin A/B family lipoprotein | Antitoxin |
AMD20_RS20510 | 4650330..4651253 | - | 924 | WP_005927745.1 | arginase | - |
AMD20_RS20515 | 4651574..4652026 | + | 453 | WP_003486611.1 | roadblock/LC7 domain-containing protein | - |
AMD20_RS20520 | 4652090..4652449 | + | 360 | WP_003486613.1 | hypothetical protein | - |
AMD20_RS20525 | 4652546..4653463 | + | 918 | WP_011052673.1 | hypothetical protein | - |
AMD20_RS20530 | 4653460..4654002 | + | 543 | WP_003486615.1 | GTPase | - |
AMD20_RS20535 | 4654440..4655123 | + | 684 | WP_011052674.1 | dTMP kinase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4459.32 Da Isoelectric Point: 9.3487
>T48067 WP_005914328.1 NZ_CP009010:c4649996-4649862 [Xanthomonas citri pv. citri]
MKRAIVLLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK
MKRAIVLLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK
Download Length: 135 bp
>T48067 NZ_CP009010:c4649996-4649862 [Xanthomonas citri pv. citri]
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
Antitoxin
Download Length: 51 a.a. Molecular weight: 5122.07 Da Isoelectric Point: 8.7942
>AT48067 WP_003486606.1 NZ_CP009010:c4650223-4650071 [Xanthomonas citri pv. citri]
MKRLLTLMVLGLFSAGVMTGCNTVAGAGKDMQGAGNKVEKTAEKCSDGKC
MKRLLTLMVLGLFSAGVMTGCNTVAGAGKDMQGAGNKVEKTAEKCSDGKC
Download Length: 153 bp
>AT48067 NZ_CP009010:c4650223-4650071 [Xanthomonas citri pv. citri]
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCCGGCGC
CGGCAAGGACATGCAGGGTGCGGGCAACAAGGTCGAGAAAACGGCCGAAAAATGCAGCGACGGTAAGTGCTGA
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCCGGCGC
CGGCAAGGACATGCAGGGTGCGGGCAACAAGGTCGAGAAAACGGCCGAAAAATGCAGCGACGGTAAGTGCTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G2W7U6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828YLX6 |