Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | EcnAB/- |
Location | 4649878..4650239 | Replicon | chromosome |
Accession | NZ_CP008998 | ||
Organism | Xanthomonas citri pv. citri strain MN12 |
Toxin (Protein)
Gene name | EcnB | Uniprot ID | M4UGA1 |
Locus tag | AMD14_RS20495 | Protein ID | WP_005914328.1 |
Coordinates | 4649878..4650012 (-) | Length | 45 a.a. |
Antitoxin (Protein)
Gene name | EcnA | Uniprot ID | H8FG64 |
Locus tag | AMD14_RS20500 | Protein ID | WP_003486606.1 |
Coordinates | 4650087..4650239 (-) | Length | 51 a.a. |
Genomic Context
Location: 4651590..4652042 (453 bp)
Type: Others
Protein ID: WP_003486611.1
Type: Others
Protein ID: WP_003486611.1
Location: 4652106..4652465 (360 bp)
Type: Others
Protein ID: WP_003486613.1
Type: Others
Protein ID: WP_003486613.1
Location: 4652562..4653479 (918 bp)
Type: Others
Protein ID: WP_011052673.1
Type: Others
Protein ID: WP_011052673.1
Location: 4653476..4654018 (543 bp)
Type: Others
Protein ID: WP_003486615.1
Type: Others
Protein ID: WP_003486615.1
Location: 4654456..4655139 (684 bp)
Type: Others
Protein ID: WP_011052674.1
Type: Others
Protein ID: WP_011052674.1
Location: 4645016..4646707 (1692 bp)
Type: Others
Protein ID: WP_015471463.1
Type: Others
Protein ID: WP_015471463.1
Location: 4646899..4647933 (1035 bp)
Type: Others
Protein ID: WP_011052671.1
Type: Others
Protein ID: WP_011052671.1
Location: 4647972..4649261 (1290 bp)
Type: Others
Protein ID: WP_015463705.1
Type: Others
Protein ID: WP_015463705.1
Location: 4649442..4649651 (210 bp)
Type: Others
Protein ID: WP_003486601.1
Type: Others
Protein ID: WP_003486601.1
Location: 4649878..4650012 (135 bp)
Type: Toxin
Protein ID: WP_005914328.1
Type: Toxin
Protein ID: WP_005914328.1
Location: 4650087..4650239 (153 bp)
Type: Antitoxin
Protein ID: WP_003486606.1
Type: Antitoxin
Protein ID: WP_003486606.1
Location: 4650346..4651269 (924 bp)
Type: Others
Protein ID: WP_005927745.1
Type: Others
Protein ID: WP_005927745.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AMD14_RS20475 | 4645016..4646707 | - | 1692 | WP_015471463.1 | M20/M25/M40 family metallo-hydrolase | - |
AMD14_RS20480 | 4646899..4647933 | - | 1035 | WP_011052671.1 | MBL fold metallo-hydrolase | - |
AMD14_RS20485 | 4647972..4649261 | - | 1290 | WP_015463705.1 | tryptophan--tRNA ligase | - |
AMD14_RS20490 | 4649442..4649651 | - | 210 | WP_003486601.1 | CsbD family protein | - |
AMD14_RS20495 | 4649878..4650012 | - | 135 | WP_005914328.1 | entericidin A/B family lipoprotein | Toxin |
AMD14_RS20500 | 4650087..4650239 | - | 153 | WP_003486606.1 | entericidin A/B family lipoprotein | Antitoxin |
AMD14_RS20505 | 4650346..4651269 | - | 924 | WP_005927745.1 | arginase | - |
AMD14_RS20510 | 4651590..4652042 | + | 453 | WP_003486611.1 | roadblock/LC7 domain-containing protein | - |
AMD14_RS20515 | 4652106..4652465 | + | 360 | WP_003486613.1 | hypothetical protein | - |
AMD14_RS20520 | 4652562..4653479 | + | 918 | WP_011052673.1 | hypothetical protein | - |
AMD14_RS20525 | 4653476..4654018 | + | 543 | WP_003486615.1 | GTPase | - |
AMD14_RS20530 | 4654456..4655139 | + | 684 | WP_011052674.1 | dTMP kinase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4459.32 Da Isoelectric Point: 9.3487
>T48035 WP_005914328.1 NZ_CP008998:c4650012-4649878 [Xanthomonas citri pv. citri]
MKRAIVLLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK
MKRAIVLLVLSMLSVGMLAGCNTVAGAGKDVQGAGEKVEDAARK
Download Length: 135 bp
>T48035 NZ_CP008998:c4650012-4649878 [Xanthomonas citri pv. citri]
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
ATGAAGCGTGCAATTGTGCTGCTGGTGCTGTCGATGTTGTCGGTGGGAATGCTGGCGGGTTGCAACACCGTCGCAGGTGC
CGGCAAGGACGTGCAGGGCGCTGGCGAGAAGGTGGAAGACGCAGCGCGTAAGTAA
Antitoxin
Download Length: 51 a.a. Molecular weight: 5122.07 Da Isoelectric Point: 8.7942
>AT48035 WP_003486606.1 NZ_CP008998:c4650239-4650087 [Xanthomonas citri pv. citri]
MKRLLTLMVLGLFSAGVMTGCNTVAGAGKDMQGAGNKVEKTAEKCSDGKC
MKRLLTLMVLGLFSAGVMTGCNTVAGAGKDMQGAGNKVEKTAEKCSDGKC
Download Length: 153 bp
>AT48035 NZ_CP008998:c4650239-4650087 [Xanthomonas citri pv. citri]
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCCGGCGC
CGGCAAGGACATGCAGGGTGCGGGCAACAAGGTCGAGAAAACGGCCGAAAAATGCAGCGACGGTAAGTGCTGA
ATGAAGCGACTGCTGACACTGATGGTGCTGGGCCTGTTTTCGGCCGGCGTGATGACGGGCTGCAACACCGTGGCCGGCGC
CGGCAAGGACATGCAGGGTGCGGGCAACAAGGTCGAGAAAACGGCCGAAAAATGCAGCGACGGTAAGTGCTGA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G2W7U6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828YLX6 |